DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3927 and vamp-7

DIOPT Version :9

Sequence 1:NP_611681.1 Gene:CG3927 / 37576 FlyBaseID:FBgn0034739 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_500232.3 Gene:vamp-7 / 177041 WormBaseID:WBGene00022077 Length:261 Species:Caenorhabditis elegans


Alignment Length:98 Identity:21/98 - (21%)
Similarity:37/98 - (37%) Gaps:22/98 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 YAHLHKDLFLEV--SAVAPPAECYARIAYALAEIRKYLIPDDNDDVWHEQQRELMEMNPKSAKKS 207
            :.||:.|.||:.  :...|.|:     ...:.:||:.:  ||...|..:....:||...:     
 Worm   147 FFHLNLDFFLQKQHNETFPTAQ-----QQRMIDIRRQV--DDVRQVMADNVERIMERGER----- 199

  Fly   208 NGLNMAPYRSNFDKAIGAIRNRAPKYNNQIRRV 240
                    ..|.:....|:|..|..:.:..|||
 Worm   200 --------LENMENRTEALRTSATSFKSTARRV 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3927NP_611681.1 SF1_like-KH 83..201 CDD:239088 14/57 (25%)
vamp-7NP_500232.3 Synaptobrevin 168..256 CDD:366387 14/77 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.