DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3927 and B0280.11

DIOPT Version :9

Sequence 1:NP_611681.1 Gene:CG3927 / 37576 FlyBaseID:FBgn0034739 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_498560.2 Gene:B0280.11 / 175997 WormBaseID:WBGene00015106 Length:441 Species:Caenorhabditis elegans


Alignment Length:226 Identity:43/226 - (19%)
Similarity:75/226 - (33%) Gaps:72/226 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ETPSELTEKQNQDQPTYQPRLNEVAQ------KFLADLDAERKRLSAEF-PLCALLID------- 52
            :|||.:..::.:.|.........|.:      :.|..|...||.|.|:| |:..:.:|       
 Worm    98 KTPSTIALRRAESQMELSGNRKNVEKGVKTWVEQLEKLVEIRKLLEADFKPIDTMKVDLEKCQAF 162

  Fly    53 -ESVD-------RVYSTGRIPGKEPFADVYQQKPMKIIQKVFVPVNKFPKFNFTGKILG--PKGN 107
             :::|       .:|...|:.|... ||.:..          ..|...|..:....||.  |..:
 Worm   163 KKNIDYCQSENVELYDANRVKGGGE-ADFFYH----------ATVTSIPSISTKSTILAQLPLSD 216

  Fly   108 SLRRLQ-------------------EETHCKIVI--------KGRNSMRDRNKEEELRSSGDPRY 145
            |...|:                   |:...|..:        |...::|..|::...:|...|  
 Worm   217 SPHSLESFWLMVAAQKIQRLFILIGEDELDKAALSEYFPEDFKEFKTIRVNNRKTVSKSDEQP-- 279

  Fly   146 AHLHKDLFLEVSAVAPPAECYARIAYALAEI 176
               :..|:.||    .|.:| |...:|:.||
 Worm   280 ---NTQLYYEV----VPKDC-AEAPFAMIEI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3927NP_611681.1 SF1_like-KH 83..201 CDD:239088 23/123 (19%)
B0280.11NP_498560.2 PTPc 141..398 CDD:214550 34/183 (19%)
PTPc 177..394 CDD:304379 28/147 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.731683 Normalized mean entropy S1317
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.