DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3927 and gld-1

DIOPT Version :9

Sequence 1:NP_611681.1 Gene:CG3927 / 37576 FlyBaseID:FBgn0034739 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_492143.1 Gene:gld-1 / 172532 WormBaseID:WBGene00001595 Length:463 Species:Caenorhabditis elegans


Alignment Length:236 Identity:71/236 - (30%)
Similarity:122/236 - (51%) Gaps:34/236 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KQNQDQPTYQPRLNEVAQ-----KFLADLDAERKRLSA---EFPLCALLIDESVDRV----YST- 61
            |.:.|:..:.|...|..:     ::||||..|:|.|:.   .|.....|:|:.:.||    :.| 
 Worm   125 KSSMDKSLFSPTATEPIEVEATVEYLADLVKEKKHLTLFPHMFSNVERLLDDEIGRVRVALFQTE 189

  Fly    62 -GRIPGKEPFADVYQQKPMKIIQKVFVPVNKFPKFNFTGKILGPKGNSLRRLQEETHCKIVIKGR 125
             .|:...||..|:     :.|.:|::||.|::|.:||.|:||||:|.:.::|:::|.|||:::|:
 Worm   190 FPRVELPEPAGDM-----ISITEKIYVPKNEYPDYNFVGRILGPRGMTAKQLEQDTGCKIMVRGK 249

  Fly   126 NSMRDRNKEEELRSSGDPRYAHLHKDLFLEVSAVAPPAECYARIAYALAEIRKYLI--PDDNDDV 188
            .||||::||...|  |...:.||..||.:.|.........:.::..||.:::|.||  |:..|::
 Worm   250 GSMRDKSKESAHR--GKANWEHLEDDLHVLVQCEDTENRVHIKLQAALEQVKKLLIPAPEGTDEL 312

  Fly   189 WHEQQRELMEMN--------PKSAKKSNG---LNMAPYRSN 218
            ..:|..||..:|        |..|:....   |:..|.||:
 Worm   313 KRKQLMELAIINGTYRPMKSPNPARVMTAVPLLSPTPLRSS 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3927NP_611681.1 SF1_like-KH 83..201 CDD:239088 43/127 (34%)
gld-1NP_492143.1 STAR_dimer 144..190 CDD:293152 13/45 (29%)
SF1_like-KH 206..328 CDD:239088 43/123 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.