DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3927 and Khdrbs2

DIOPT Version :9

Sequence 1:NP_611681.1 Gene:CG3927 / 37576 FlyBaseID:FBgn0034739 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_579852.1 Gene:Khdrbs2 / 170843 RGDID:621738 Length:349 Species:Rattus norvegicus


Alignment Length:196 Identity:84/196 - (42%)
Similarity:126/196 - (64%) Gaps:8/196 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QKFLADLDAERKRLSAEFPLCALLIDESVDRVY-STGRIPGKE-PFADVYQQKPMKIIQKVFVPV 89
            :|:|.:|.||:..|...|...:.|:.|.:::.. |.||...:| .:.||...|.:|:.::|.:||
  Rat     4 EKYLPELMAEKDSLDPSFVHASRLLAEEIEKFQGSDGRKEDEEKKYLDVISNKNIKLSERVLIPV 68

  Fly    90 NKFPKFNFTGKILGPKGNSLRRLQEETHCKIVIKGRNSMRDRNKEEELRSSGDPRYAHLHKDLFL 154
            .::|||||.||:|||:||||:||||||..|:.|.|:.||||:.||||||.||:.:||||..:|.:
  Rat    69 KQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKAKEEELRKSGEAKYAHLSDELHV 133

  Fly   155 EVSAVAPPAECYARIAYALAEIRKYLIPDDNDDVWHEQQRELMEMNPKSAK------KSNGLNMA 213
            .:...|||.|.|:|:::||.||:|:|:||.||::..||.|||..:|.....      :..|:.:.
  Rat   134 LIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSEESGRGRGIRGRGIRIT 198

  Fly   214 P 214
            |
  Rat   199 P 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3927NP_611681.1 SF1_like-KH 83..201 CDD:239088 64/117 (55%)
Khdrbs2NP_579852.1 Qua1 6..57 CDD:292891 14/50 (28%)
SF1_like-KH 61..180 CDD:239088 64/118 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 181..263 2/19 (11%)
Sam68-YY 271..321 CDD:293176
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 320..349
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348932
Domainoid 1 1.000 54 1.000 Domainoid score I10913
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I4063
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8931
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.860

Return to query results.
Submit another query.