DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3927 and Khdrbs1

DIOPT Version :9

Sequence 1:NP_611681.1 Gene:CG3927 / 37576 FlyBaseID:FBgn0034739 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_569089.1 Gene:Khdrbs1 / 117268 RGDID:621459 Length:443 Species:Rattus norvegicus


Alignment Length:178 Identity:77/178 - (43%)
Similarity:116/178 - (65%) Gaps:1/178 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EVAQKFLADLDAERKRLSAEFPLCALLIDESVDRVY-STGRIPGKEPFADVYQQKPMKIIQKVFV 87
            |...|:|.:|.||:..|...|.....|:...::::. ...:...:|.:.|::..|.||:.::|.:
  Rat    98 EPENKYLPELMAEKDSLDPSFTHAMQLLSVEIEKIQKGESKKDDEENYLDLFSHKNMKLKERVLI 162

  Fly    88 PVNKFPKFNFTGKILGPKGNSLRRLQEETHCKIVIKGRNSMRDRNKEEELRSSGDPRYAHLHKDL 152
            ||.::|||||.||||||:||:::||||||..||.:.|:.||||:.||||||..|||:||||:.||
  Rat   163 PVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDL 227

  Fly   153 FLEVSAVAPPAECYARIAYALAEIRKYLIPDDNDDVWHEQQRELMEMN 200
            .:.:....||.|.||.:|:|:.|::|:|:||..||:..||..||..:|
  Rat   228 HVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLN 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3927NP_611681.1 SF1_like-KH 83..201 CDD:239088 63/118 (53%)
Khdrbs1NP_569089.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..95
Involved in homodimerization. /evidence=ECO:0000250|UniProtKB:Q07666 100..260 69/159 (43%)
Qua1 102..153 CDD:406639 10/50 (20%)
KH-I 152..257 CDD:412160 57/104 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..317
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 326..345
Interaction with HNRNPA1. /evidence=ECO:0000250|UniProtKB:Q07666 351..443
Sam68-YY 366..415 CDD:406871
Interaction with ZBTB7A. /evidence=ECO:0000250|UniProtKB:Q07666 400..420
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 411..443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348940
Domainoid 1 1.000 54 1.000 Domainoid score I10913
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I4063
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8931
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.