DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3927 and qkib

DIOPT Version :9

Sequence 1:NP_611681.1 Gene:CG3927 / 37576 FlyBaseID:FBgn0034739 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_021336383.1 Gene:qkib / 100462714 ZFINID:ZDB-GENE-081028-54 Length:176 Species:Danio rerio


Alignment Length:188 Identity:55/188 - (29%)
Similarity:96/188 - (51%) Gaps:36/188 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EKQNQDQPTYQPRLNEVAQKFLADLDAERKRLSAEFPLCAL------LIDESVDRVYSTGRIPGK 67
            |.:.:::|...|       .:|..|..::|.:|:....|.:      |:||.:.||       .|
Zfish     4 EMETKEKPKPTP-------DYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRV-------RK 54

  Fly    68 EPFADVYQQKPMK-----------IIQ---KVFVPVNKFPKFNFTGKILGPKGNSLRRLQEETHC 118
            :.:.|.......|           |:|   |::|||.::|.|||.|:||||:|.:.::|:.||.|
Zfish    55 DMYNDTLNGSTEKRSSELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGC 119

  Fly   119 KIVIKGRNSMRDRNKEEELRSSGDPRYAHLHKDLFLEVSAVAPPAECYARIAYALAEI 176
            ||:::|:.||||:.|||:.|  |.|.:.||::||.:.::..........::..|:.|:
Zfish   120 KIMVRGKGSMRDKKKEEQNR--GKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEV 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3927NP_611681.1 SF1_like-KH 83..201 CDD:239088 38/97 (39%)
qkibXP_021336383.1 STAR_dimer 10..68 CDD:318695 14/71 (20%)
SF1_like-KH 83..>175 CDD:239088 36/93 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.