DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3927 and khdrbs3

DIOPT Version :9

Sequence 1:NP_611681.1 Gene:CG3927 / 37576 FlyBaseID:FBgn0034739 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_002932263.1 Gene:khdrbs3 / 100379996 XenbaseID:XB-GENE-941483 Length:342 Species:Xenopus tropicalis


Alignment Length:281 Identity:98/281 - (34%)
Similarity:144/281 - (51%) Gaps:61/281 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QKFLADLDAERKRLSAEFPLCALLIDESVDRVYSTGRIPGKEPFADVYQQKPMKIIQKVFVPVNK 91
            :|:|..|.||:..|...|.....::.|.:::: ..|....::.:.||...|.||:.|||.:|:.:
 Frog     2 EKYLPQLLAEKDALDPSFTHALRMVKEEIEKL-QKGEDNTEDQYIDVVINKNMKLAQKVLIPIKQ 65

  Fly    92 FPKFNFTGKILGPKGNSLRRLQEETHCKIVIKGRNSMRDRNKEEELRSSGDPRYAHLHKDLFLEV 156
            ||||||.||:|||:||||:||||:|..|:.|.|:.||||:.||||||.||:.:|.||:.||.:.:
 Frog    66 FPKFNFVGKLLGPRGNSLKRLQEDTLTKMSILGKGSMRDKAKEEELRKSGEAKYYHLNDDLHVLI 130

  Fly   157 SAVAPPAECYARIAYALAEIRKYLIPDDNDDVWHEQQRELMEMN--------------------- 200
            ...|||||.|||:.:||.||:|:||||.||::...|.:||..:|                     
 Frog   131 EVFAPPAEAYARMGHALEEIKKFLIPDYNDEIRQAQLQELTYLNGGPETTEAPVVRGKPSIRARG 195

  Fly   201 --------------------PKSAKKSNGLNMAPYRSNFDKAIGAIRNRAPKYNNQIRRVTENPR 245
                                |:.|....|  :.|.|.:..:|.|.:..||       |.:   |.
 Frog   196 VPVPALPRGRGGVPPAPTGVPRGAPAPRG--VTPARVSSARARGLVATRA-------RGI---PP 248

  Fly   246 EVAY-----MEEV--EYDYDE 259
            ...|     :::.  |||||:
 Frog   249 PAGYRPPPPVQDTYGEYDYDD 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3927NP_611681.1 SF1_like-KH 83..201 CDD:239088 67/158 (42%)
khdrbs3XP_002932263.1 Qua1 3..52 CDD:374463 11/49 (22%)
SF1_like-KH 57..176 CDD:239088 67/118 (57%)
PHA03381 <193..>233 CDD:177618 5/41 (12%)
Sam68-YY 262..316 CDD:374636 5/8 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10668
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9347
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.