DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnr1 and Birc2

DIOPT Version :9

Sequence 1:NP_001261137.1 Gene:dnr1 / 37575 FlyBaseID:FBgn0260866 Length:696 Species:Drosophila melanogaster
Sequence 2:NP_068520.2 Gene:Birc2 / 60371 RGDID:620690 Length:589 Species:Rattus norvegicus


Alignment Length:54 Identity:23/54 - (42%)
Similarity:32/54 - (59%) Gaps:0/54 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   541 RISEAMQCKICMDRAINTVFNPCCHVIACAQCAARCSNCPNCRVKITSVVKIYL 594
            |:.|...||:||||.::.||.||.|::.|.:||.....||.||..|...|:.:|
  Rat   535 RLQEERTCKVCMDREVSIVFIPCGHLVVCRECAPSLRKCPICRGTIKGTVRTFL 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dnr1NP_001261137.1 B41 3..>143 CDD:214604
FERM_N 5..67 CDD:286467
FERM_M 93..>143 CDD:278785
FERM_C_MYLIP_IDOL 325..435 CDD:270016
zf-C3HC4_3 544..589 CDD:290631 20/44 (45%)
Birc2NP_068520.2 BIR 24..93 CDD:197595
BIR 155..224 CDD:197595
BIR 240..308 CDD:197595
UBA_BIRC2_3 362..408 CDD:270577
CARD_BIRC2_BIRC3 425..514 CDD:260038
zf-C3HC4_3 538..583 CDD:290631 20/44 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340284at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.