powered by:
Protein Alignment dnr1 and Birc2
DIOPT Version :9
Sequence 1: | NP_001261137.1 |
Gene: | dnr1 / 37575 |
FlyBaseID: | FBgn0260866 |
Length: | 696 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_068520.2 |
Gene: | Birc2 / 60371 |
RGDID: | 620690 |
Length: | 589 |
Species: | Rattus norvegicus |
Alignment Length: | 54 |
Identity: | 23/54 - (42%) |
Similarity: | 32/54 - (59%) |
Gaps: | 0/54 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 541 RISEAMQCKICMDRAINTVFNPCCHVIACAQCAARCSNCPNCRVKITSVVKIYL 594
|:.|...||:||||.::.||.||.|::.|.:||.....||.||..|...|:.:|
Rat 535 RLQEERTCKVCMDREVSIVFIPCGHLVVCRECAPSLRKCPICRGTIKGTVRTFL 588
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1340284at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.