DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnr1 and xiap

DIOPT Version :9

Sequence 1:NP_001261137.1 Gene:dnr1 / 37575 FlyBaseID:FBgn0260866 Length:696 Species:Drosophila melanogaster
Sequence 2:NP_919377.2 Gene:xiap / 373108 ZFINID:ZDB-GENE-030825-7 Length:405 Species:Danio rerio


Alignment Length:149 Identity:38/149 - (25%)
Similarity:54/149 - (36%) Gaps:42/149 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   445 ELGKRYVFDIQHTCREVHDQARRTLHERGGDLVAEGAEGCSAVAGGLGASAVGEPGVSPWAMALT 509
            |.|:.||..:|....:...|...:.||.|..                             |.||.
Zfish   297 EKGEEYVSSVQLRYPKRPTQNGFSSHESGSS-----------------------------AQALI 332

  Fly   510 TGAGGSMAGKIDLAIREKEAREAAIERCVDTRISEAMQCKICMDRAINTVFNPCCHVIACAQCAA 574
            .|: ..|..|.:..:.|.|            ::.....||:|||..|:.||.||.|::.|.:|:|
Zfish   333 HGS-SDMFEKAEDPMTELE------------KLQREKLCKVCMDSDISIVFIPCGHLVTCQKCSA 384

  Fly   575 RCSNCPNCRVKITSVVKIY 593
            ....||.|...||..:|.|
Zfish   385 SLDKCPICCATITQKIKTY 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dnr1NP_001261137.1 B41 3..>143 CDD:214604
FERM_N 5..67 CDD:286467
FERM_M 93..>143 CDD:278785
FERM_C_MYLIP_IDOL 325..435 CDD:270016
zf-C3HC4_3 544..589 CDD:290631 19/44 (43%)
xiapNP_919377.2 BIR 23..89 CDD:237989
BIR 138..206 CDD:237989
BIR 230..296 CDD:237989
zf-C3HC4_3 354..398 CDD:290631 18/43 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340284at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.