DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnr1 and XIAP

DIOPT Version :9

Sequence 1:NP_001261137.1 Gene:dnr1 / 37575 FlyBaseID:FBgn0260866 Length:696 Species:Drosophila melanogaster
Sequence 2:NP_001158.2 Gene:XIAP / 331 HGNCID:592 Length:497 Species:Homo sapiens


Alignment Length:527 Identity:110/527 - (20%)
Similarity:177/527 - (33%) Gaps:159/527 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 KEKEHVLSFKKRRLSKQKSMEHIEVCTLPAASTTSCSLQPSPSASASASASASASASASTSACSQ 242
            ||:|.|..|.:.:          .....|:.|..        |||..|.|....:....|..|..
Human    19 KEEEFVEEFNRLK----------TFANFPSGSPV--------SASTLARAGFLYTGEGDTVRCFS 65

  Fly   243 THS------------------------------NSSSSSPSNSSSQTG---LDERLASNPLRVYE 274
            .|:                              .:|::..:||..|.|   ::..|.|      .
Human    66 CHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQSTNSGIQNGQYKVENYLGS------R 124

  Fly   275 EYFM--QPSCEGEPPADYLRQIAVEHGKLAKLQMSL---KTAKY---WLLKSIQDLEGYGEELFS 331
            ::|.  :||   |..||||    :..|::..:..::   ..|.|   ..|||.|:...|..    
Human   125 DHFALDRPS---ETHADYL----LRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAH---- 178

  Fly   332 GVTTNE--SATRCDIAVGAHGITVCRGGE--------------KQSIPFGAIAAAKSLRRTFKLE 380
             :|..|  ||......:|......|.||:              ::..|.......::|....:.:
Human   179 -LTPRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSESD 242

  Fly   381 YVDDHNDRK-ELEIKLPKQPIAAG-----------LYRSITE---RHAFYVC---DKVR-----G 422
            .|.  :||. .....||:.|..|.           :|....|   |..||..   |||:     |
Human   243 AVS--SDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGG 305

  Fly   423 VVTN---------QFTRDLKGTIASMFMENTELGKRYVFDIQHTCREVHDQARRT------LHER 472
            .:|:         |..:...|  ....:|  :.|:.|:.:| |....:.:...||      |..|
Human   306 GLTDWKPSEDPWEQHAKWYPG--CKYLLE--QKGQEYINNI-HLTHSLEECLVRTTEKTPSLTRR 365

  Fly   473 GGDLVAEGAEGCSAVAGGLGASAVGEPGVSPWAMALTTGAGGSMAGKIDLAI----------REK 527
            ..|.:.:......|:..|.....:.:      .|.......||....:::.:          .:.
Human   366 IDDTIFQNPMVQEAIRMGFSFKDIKK------IMEEKIQISGSNYKSLEVLVADLVNAQKDSMQD 424

  Fly   528 EAREAAIERCVDT-----RISEAMQCKICMDRAINTVFNPCCHVIACAQCAARCSNCPNCRVKIT 587
            |:.:.::::.:.|     |:.|...|||||||.|..||.||.|::.|.|||.....||.|...||
Human   425 ESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVIT 489

  Fly   588 SVVKIYL 594
            ...||::
Human   490 FKQKIFM 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dnr1NP_001261137.1 B41 3..>143 CDD:214604
FERM_N 5..67 CDD:286467
FERM_M 93..>143 CDD:278785
FERM_C_MYLIP_IDOL 325..435 CDD:270016 29/157 (18%)
zf-C3HC4_3 544..589 CDD:290631 23/44 (52%)
XIAPNP_001158.2 BIR 1 26..93 11/84 (13%)
BIR 28..95 CDD:237989 10/84 (12%)
Interaction with caspase-7 141..149 1/7 (14%)
BIR 162..232 CDD:197595 14/74 (19%)
BIR 2 163..230 14/71 (20%)
BIR 265..331 CDD:197595 12/67 (18%)
BIR 3 265..330 12/66 (18%)
UBA_BIRC4_8 370..419 CDD:270578 5/54 (9%)
RING-HC_BIRC4_8 436..497 CDD:319628 27/61 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340284at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.