DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment dnr1 and Birc2

DIOPT Version :9

Sequence 1:	NP_001261137.1	Gene:	dnr1 / 37575	FlyBaseID:	FBgn0260866	Length:	696	Species:	Drosophila melanogaster
Sequence 2:	NP_001278432.1	Gene:	Birc2 / 11797	MGIID:	1197009	Length:	612	Species:	Mus musculus

Alignment Length:	54	Identity:	23/54 - (42%)
Similarity:	32/54 - (59%)	Gaps:	0/54 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   541 RISEAMQCKICMDRAINTVFNPCCHVIACAQCAARCSNCPNCRVKITSVVKIYL 594
            |:.|...||:||||.::.||.||.|::.|.:||.....||.||..|...|:.:|
Mouse   558 RLQEERTCKVCMDREVSIVFIPCGHLVVCQECAPSLRKCPICRGTIKGTVRTFL 611

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
dnr1	NP_001261137.1	B41	3..>143	CDD:214604
		FERM_N	5..67	CDD:286467
		FERM_M	93..>143	CDD:278785
		FERM_C_MYLIP_IDOL	325..435	CDD:270016
		zf-C3HC4_3	544..589	CDD:290631	20/44 (45%)
Birc2	NP_001278432.1	BIR	45..114	CDD:197595
		BIR 1	46..113
		BIR	176..245	CDD:197595
		BIR 2	177..243
		BIR 3	262..329
		BIR	263..329	CDD:237989
		UBA_BIRC2_3	385..431	CDD:270577
		CARD_BIRC2_BIRC3	447..538	CDD:260038
		RING-HC_BIRC2_3_7	559..612	CDD:319627	22/53 (42%)
		RING-HC finger (C3HC4-type)	565..599	CDD:319627	16/33 (48%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1340284at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	3	2.920