DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnr1 and birc7

DIOPT Version :9

Sequence 1:NP_001261137.1 Gene:dnr1 / 37575 FlyBaseID:FBgn0260866 Length:696 Species:Drosophila melanogaster
Sequence 2:NP_001106593.2 Gene:birc7 / 100127811 XenbaseID:XB-GENE-5914029 Length:385 Species:Xenopus tropicalis


Alignment Length:313 Identity:65/313 - (20%)
Similarity:105/313 - (33%) Gaps:126/313 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 PPADYLRQIAVEHGKLAKLQMSLKTAKYWLLKSIQDLEGYGEELFSGVTTNESATRCDIAVGAH- 349
            |..|:|.|:..|.                .::|:|      |..||...|:..      :||:: 
 Frog   194 PMCDFLLQVKGEA----------------FIRSVQ------ESFFSSPETSPE------SVGSYE 230

  Fly   350 GITVCRGGEKQSIPFGAIAAAK-SLRRTFKLEYVDDHNDRKELEIKLPKQPIAAGLYRSITERHA 413
            |..|...|.....||.:.:.|: :|:..||.                                  
 Frog   231 GSPVSSPGSPPVCPFLSTSVAQGALQMGFKR---------------------------------- 261

  Fly   414 FYVCDKVRGVVTNQF--TRDLKGTIASMFMENTELGKRYVFDIQHTCREVHDQARRTLHERGGDL 476
                ::|..::.|:|  |....|:::.:.   |:|       ||  ..|:|              
 Frog   262 ----NRVSSLMINRFILTGSCYGSVSELV---TDL-------IQ--AEEIH-------------- 296

  Fly   477 VAEGAEGCSAVAGGLGASAVGEPGVSPWAMALTTGAGGSMAGKIDLAIREKEAREAAIERCVDTR 541
               |.|..| |..........||...| |..|:|               |::.|:          
 Frog   297 ---GTESVS-VPRAPTQRERPEPPKEP-APPLST---------------EEQLRQ---------- 331

  Fly   542 ISEAMQCKICMDRAINTVFNPCCHVIACAQCAARCSNCPNCRVKITSVVKIYL 594
            :.|...||:|||..::.||.||.|::.|.:||....:||.||..|...|:.::
 Frog   332 LKEERMCKVCMDNDVSMVFVPCGHLVVCTECAPNLRHCPICRAAIRGSVRAFM 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dnr1NP_001261137.1 B41 3..>143 CDD:214604
FERM_N 5..67 CDD:286467
FERM_M 93..>143 CDD:278785
FERM_C_MYLIP_IDOL 325..435 CDD:270016 19/113 (17%)
zf-C3HC4_3 544..589 CDD:290631 19/44 (43%)
birc7NP_001106593.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340284at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.