DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gas and Bche

DIOPT Version :9

Sequence 1:NP_611678.1 Gene:gas / 37572 FlyBaseID:FBgn0034736 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_075231.1 Gene:Bche / 65036 RGDID:619996 Length:597 Species:Rattus norvegicus


Alignment Length:545 Identity:155/545 - (28%)
Similarity:243/545 - (44%) Gaps:116/545 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GTGQTKE---LATKYGQLKGQQRRTLYDGEPYYSFEGIPFAQPPVGELRFRAPQPPSSWQGVRDC 89
            |...|:|   :.||.|:::|.....|  |....:|.|||:||||:|.|||:.|||.:.|..|.:.
  Rat    19 GKSHTEEDVIITTKTGRVRGLSMPIL--GGTVTAFLGIPYAQPPLGSLRFKKPQPLNKWPDVYNA 81

  Fly    90 TYAREKPMQRNSITNAAEG-------------SEDCLYLNVYAKRLESPKPLPVMVWIFGGGFQV 141
            |.......|  :|..|..|             |||||||||:.. :..||...||||::|||||.
  Rat    82 TKYANSCYQ--NIDQAFPGFQGSEMWNPNTNLSEDCLYLNVWIP-VPKPKNATVMVWVYGGGFQT 143

  Fly   142 GGASRELYGPDYFMKHD-ILLVTINYRVGVLGFLSLKDKELKIPGNAGLKDQIQALRWVKENIAS 205
            |.:|..:|...:..:.: :::|::|||||.||||:..... :.|||.||.||..||:|::.|||:
  Rat   144 GTSSLPVYDGKFLTRVERVIVVSMNYRVGALGFLAFPGNS-EAPGNMGLFDQQLALQWIQRNIAA 207

  Fly   206 FNGDPESITVFGESAGGASTHILMQTEQARGLFHRAIVQSGSALCAWATQPDRKWPQR---LGKE 267
            |.|:|:|:|:||||||.||..:.:...|:..||.|||::|||:...||.:...:...|   |.|.
  Rat   208 FGGNPKSVTLFGESAGAASVSLHLLCPQSYPLFTRAILESGSSNAPWAVKHPEEARNRTLTLAKF 272

  Fly   268 LGYAGNLESEKELLEFFQQIPASKLAQYCNSIVTQEEQRDYEILAFAPVIEPYVGDDCVIPKSQQ 332
            :|.  :.|:|||::...:.....::......::..:..|.   :.|.|.::   ||.........
  Rat   273 IGC--SKENEKEIITCLRSKDPQEILLNEKLVLPSDSIRS---INFGPTVD---GDFLTDMPHTL 329

  Fly   333 EQLSSAWGNSIPMIIG-----GTSF----------------------EGLFSYRTTLDDPLYMLS 370
            .||...  .:..:::|     ||:|                      |||..|     .|.....
  Rat   330 LQLGKV--KTAQILVGVNKDEGTAFLVYGAPGFSKDNDSLITRREFQEGLNMY-----FPGVSSL 387

  Fly   371 AFEAIIPKQVRDAIDKEELAEMVRRLKKSYFDD---------PDRASMELYECLHILSIKNFWHD 426
            ..|||:...|      :.|.:....:.:..|||         |   ::|..:....|.|..|::.
  Rat   388 GKEAILFYYV------DWLGDQTPEVYREAFDDIIGDYNIICP---ALEFTKKFAELEINAFFYY 443

  Fly   427 I-HRTLLARLAYATNLPTYLYRFDMDSPHFNHYRILKCGKKVRGVCHADDISYMFYGILSSKLDK 490
            . ||:  ::|.:    |.::                       ||.|..:|.::|...|..:::.
  Rat   444 FEHRS--SKLPW----PEWM-----------------------GVMHGYEIEFVFGLPLERRVNY 479

  Fly   491 NSPEYRTIERLVGMWTSFATTGDPN 515
            ...|......::..|.:||..|.||
  Rat   480 TRAEEIFSRSIMKTWANFAKYGHPN 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gasNP_611678.1 COesterase 28..534 CDD:278561 155/545 (28%)
Aes <117..>222 CDD:223730 48/105 (46%)
BcheNP_075231.1 COesterase 21..545 CDD:278561 154/543 (28%)
Aes <120..>272 CDD:223730 64/153 (42%)
AChE_tetra 560..594 CDD:285837
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100080
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.