DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gas and NLGN4X

DIOPT Version :9

Sequence 1:NP_611678.1 Gene:gas / 37572 FlyBaseID:FBgn0034736 Length:566 Species:Drosophila melanogaster
Sequence 2:XP_005274621.1 Gene:NLGN4X / 57502 HGNCID:14287 Length:836 Species:Homo sapiens


Alignment Length:619 Identity:176/619 - (28%)
Similarity:268/619 - (43%) Gaps:168/619 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TKYGQLKGQQRRTLYDGE---PYYSFEGIPFAQPPVGELRFRAPQPPSSWQGVRDCT-YAREKPM 97
            |.||:::|  .||....|   |...:.|:|:|.||.||.||:.|:|||||.|:|:.| :|...|.
Human    50 TNYGKIRG--LRTPLPNEILGPVEQYLGVPYASPPTGERRFQPPEPPSSWTGIRNTTQFAAVCPQ 112

  Fly    98 QRNS-------------------ITNAAEGSEDCLYLNVYAKRLE-------------------- 123
            ..:.                   :|...:.:|||||||:|....:                    
Human   113 HLDERSLLHDMLPIWFTANLDTLMTYVQDQNEDCLYLNIYVPTEDGANTKKNADDITSNDRGEDE 177

  Fly   124 ------SPKPLPVMVWIFGGGFQVG------GASRELYGPDYFMKHDILLVTINYRVGVLGFLSL 176
                  |.|  ||||:|.||.:..|      |:....||       :::::|||||:|:|||||.
Human   178 DIHDQNSKK--PVMVYIHGGSYMEGTGNMIDGSILASYG-------NVIVITINYRLGILGFLST 233

  Fly   177 KDKELKIPGNAGLKDQIQALRWVKENIASFNGDPESITVFGESAGGASTHILMQTEQARGLFHRA 241
            .|:..|  ||.||.||||||||::||:.:|.|||:.:|:||..||.:...:|..:..:.|||.:|
Human   234 GDQAAK--GNYGLLDQIQALRWIEENVGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKA 296

  Fly   242 IVQSGSALCAWAT--QPDRKWPQRLGKELGYAGNLESEKELLEFFQQIPASKLAQYCNSIVTQEE 304
            |:|||:||.:||.  || .|:.:.|..::|.  |:....:::|..:.....:|.|...:..|   
Human   297 IIQSGTALSSWAVNYQP-AKYTRILADKVGC--NMLDTTDMVECLRNKNYKELIQQTITPAT--- 355

  Fly   305 QRDYEILAFAPVIEPYVGDDCVIPKSQQEQLSSAWGNSIPMIIGGTSFEGLFSYRTTLDDPLYML 369
               |.| ||.|||:   ||  |||...|..:......:..:::|....|||......:|:.    
Human   356 ---YHI-AFGPVID---GD--VIPDDPQILMEQGEFLNYDIMLGVNQGEGLKFVDGIVDNE---- 407

  Fly   370 SAFEAIIPK----QVRDAID--------KEELAEMVRRLKKSYFDDPDRASMEL-YECLHILSIK 421
               :.:.|.    .|.:.:|        |:.|.|.:   |..|.|..|:.:.|. .:.|..|...
Human   408 ---DGVTPNDFDFSVSNFVDNLYGYPEGKDTLRETI---KFMYTDWADKENPETRRKTLVALFTD 466

  Fly   422 NFW-------HDIHRTLLARLAYATNLPTYLYRFDMDSPHFNHYRILKCGKKVR----GVCHADD 475
            :.|       .|:|      ..|.:  |||.|.|      ::|     |..:::    ...|.|:
Human   467 HQWVAPAVATADLH------AQYGS--PTYFYAF------YHH-----CQSEMKPSWADSAHGDE 512

  Fly   476 ISYMFYGI--------LSSKLDKNSPEYRTIERLVGMWTSFATTGDPNCEIIAPVKWDPLRPGGV 532
            :.|:| ||        .|....||......:  ::..||:||.|||||..:....|:...:|...
Human   513 VPYVF-GIPMIGPTELFSCNFSKNDVMLSAV--VMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRF 574

  Fly   533 ENCLNIADGLEFIPLPESKQFVVWDSFYTRESLY 566
            |.                   |.|..:..::.||
Human   575 EE-------------------VAWSKYNPKDQLY 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gasNP_611678.1 COesterase 28..534 CDD:278561 171/585 (29%)
Aes <117..>222 CDD:223730 49/136 (36%)
NLGN4XXP_005274621.1 COesterase 42..610 CDD:278561 176/619 (28%)
Aes <179..>286 CDD:223730 50/117 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142821
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.