DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gas and si:dkey-193c22.1

DIOPT Version :9

Sequence 1:NP_611678.1 Gene:gas / 37572 FlyBaseID:FBgn0034736 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001093504.1 Gene:si:dkey-193c22.1 / 567837 ZFINID:ZDB-GENE-030131-7957 Length:370 Species:Danio rerio


Alignment Length:158 Identity:39/158 - (24%)
Similarity:70/158 - (44%) Gaps:32/158 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 GELRFRAPQPPSSWQGVRDCTYAREKPMQR--NSITNAAEGSEDCLYLNVYAKRLE--SPKPLPV 130
            |:|.|:       |:    ..|:.:|..:.  ..||....|::..||   |:.|||  ...|:||
Zfish    70 GKLYFQ-------WK----LWYSNDKNNKHYVKGITFGRRGNKLDLY---YSPRLELSDESPVPV 120

  Fly   131 MVWIFGGGFQVGGASRELYGPDYFMKHDILLVTINYRVGVLGFLSLKDKELKIPGNA--GLKDQI 193
            :|:::||.:  |...|.:|          .|:.:.....:...:...|..:...||.  .::|..
Zfish   121 VVFVYGGAW--GSGDRSIY----------CLLALQMAKELNASVICPDYSIYPKGNVLNMVQDIS 173

  Fly   194 QALRWVKENIASFNGDPESITVFGESAG 221
            .:|.||::...:|:.|.::|.:.|.|||
Zfish   174 DSLLWVRQKGHAFSLDQDNIILIGHSAG 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gasNP_611678.1 COesterase 28..534 CDD:278561 39/158 (25%)
Aes <117..>222 CDD:223730 28/109 (26%)
si:dkey-193c22.1NP_001093504.1 Aes 87..336 CDD:223730 33/130 (25%)
Abhydrolase 121..>210 CDD:304388 21/93 (23%)
Abhydrolase 167..336 CDD:304388 11/35 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.