DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gas and Nlg3

DIOPT Version :9

Sequence 1:NP_611678.1 Gene:gas / 37572 FlyBaseID:FBgn0034736 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001036685.2 Gene:Nlg3 / 40912 FlyBaseID:FBgn0083963 Length:1159 Species:Drosophila melanogaster


Alignment Length:612 Identity:160/612 - (26%)
Similarity:230/612 - (37%) Gaps:193/612 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 DG---EPYYSFEGIPFAQPPVGELRFRAPQPPSSWQGVRDC-----------------TYAREK- 95
            ||   :|..::.|||:|.||||.|||..|...:.|.||:..                 |.|.|: 
  Fly   173 DGRHLDPVEAYRGIPYASPPVGNLRFMPPVSAAMWSGVKKADRFSPVCPQRLPDIHNETAALERM 237

  Fly    96 ------------PMQRNSITNAAEGSEDCLYLNVY------------------------------ 118
                        |..:|.       ||||||||:|                              
  Fly   238 PKGRLEYLKRLLPYLQNQ-------SEDCLYLNIYVPIQVGSRDSSGSSSSSSAGSSSSGSGGSS 295

  Fly   119 -----------AKRLESPKPLPVMVWIFGGGFQ------VGGASRELYGPDYFMKHDILLVTINY 166
                       :....||...||:|::.|..::      ..|:....||       .||:|||||
  Fly   296 SSSSSSSTSSSSAGSGSPAKYPVLVFVHGESYEWNSGNPYDGSVLASYG-------QILVVTINY 353

  Fly   167 RVGVLGFLSLK-DKELKIPGNAGLKDQIQALRWVKENIASFNGDPESITVFGESAGGASTHILMQ 230
            |:||||||:.. |:..|:|.|.||.|.|.||.|:|||||:|.|||.|||:.|...|.|..|.|:.
  Fly   354 RLGVLGFLNANTDRYSKLPANYGLMDIIAALHWLKENIAAFGGDPNSITLAGHGTGAACVHFLIS 418

  Fly   231 TEQA-RG-LFHRAIVQSGSALCAWATQPDRKWPQRLGKELGYAGNLESEKELLEFFQQIPASKLA 293
            :... .| ||:|||:.|||.|..|:...:   |.:....:.:..|..|:         :|.:.|.
  Fly   419 SMAVPEGLLFNRAILMSGSGLAPWSLVSN---PAKYAAIVAHHVNCASD---------LPHAHLM 471

  Fly   294 QYCNSIVTQEEQRDYEI------LAFAPVIEPYV--GDDCVIP------KSQQEQLSSAWGNSI- 343
            : |....|.::.....|      .||.|.|:..|  |.|.|.|      ...|.|.|:|.||.: 
  Fly   472 K-CLREKTLDQLLSVPIRPPEFGFAFGPSIDGVVIDGGDYVPPAPGSPAAQAQAQASTAAGNGLG 535

  Fly   344 ----------------------------------PMIIGGTSFEGLFSYRTTLDDPLYMLSA--F 372
                                              .::.|.|..|..||:.:  .|..|.:.|  .
  Fly   536 GEAGIAAAGGWGTPGQLENIVLMRKTAINKLSRYDLMAGVTRAEAFFSFNS--GDVQYGIEADRR 598

  Fly   373 EAIIPKQVRDAIDKEELAEMVRRLKKSYFD------DPDRASMELYECL---HILSIKNFWHDIH 428
            ..|:...||:.. ...|.|:...:...|.|      .|.....|..|.|   .:::......|:|
  Fly   599 SRILKAYVRNTY-TFHLNEIFATIVNEYTDWERPVQHPINIRDETLEALSDAQVVAPAAQTVDLH 662

  Fly   429 RTLLARLAYATNLPTYLYRFDMDSPHFNHYRILKCGKKVRGVCHADDISYMFYGILSSKLDKNSP 493
            .        |.:..:|||.||..: .|..|      .:.:|..|.:|:.|:|...|....:..:.
  Fly   663 S--------ADHRNSYLYVFDYQT-RFGDY------PQRQGCIHGEDLPYIFGAPLVGGFNHFTR 712

  Fly   494 EYRTI-----ERLVGMWTSFATTGDPN 515
            .|...     |.::..|::|..||:||
  Fly   713 NYTKTEISLSEVVMFYWSNFVRTGNPN 739

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gasNP_611678.1 COesterase 28..534 CDD:278561 160/612 (26%)
Aes <117..>222 CDD:223730 48/152 (32%)
Nlg3NP_001036685.2 COesterase 151..791 CDD:278561 160/612 (26%)
Aes <313..>410 CDD:223730 46/103 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440328
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.