DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gas and CG9287

DIOPT Version :9

Sequence 1:NP_611678.1 Gene:gas / 37572 FlyBaseID:FBgn0034736 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_609244.1 Gene:CG9287 / 34194 FlyBaseID:FBgn0032057 Length:625 Species:Drosophila melanogaster


Alignment Length:536 Identity:143/536 - (26%)
Similarity:218/536 - (40%) Gaps:104/536 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ELATKYGQLKGQQRRTLYDGEPYYSFEGIPFAQPPVGELRFRAPQPPSSWQGVRDCTYAR---EK 95
            ||.| .|.::|:...|.:.......|..:.:|:||.|..||:||:|...|:.|.|.|..:   ..
  Fly    37 ELPT-LGSIQGKILETAWTKREVLQFVDVRYAEPPTGLHRFKAPRPIEPWEDVMDATAEKIGCPS 100

  Fly    96 PMQRNSITNAAE--GSEDCLYLNVYAKRLESPKPLPVMVWIFGGGFQVGGASRELYGPDYFMKHD 158
            .:..:|:....:  ..||||.:.:....:.|  .|||:|:|.|.....|..|..  .|||.::.|
  Fly   101 VVSMDSLRRLDDVLDVEDCLTMTITTPNVTS--RLPVLVYIHGEYLYEGSNSEA--PPDYLLEKD 161

  Fly   159 ILLVTINYRVGVLGFLSLKDKELKIPGNAGLKDQIQALRWVKENIASFNGDPESITVFGESAGGA 223
            ::|||..||:|..||||.|..|  ||||||..|...||::||..|..|.|||..:||.|:..|.|
  Fly   162 VVLVTPQYRLGPFGFLSTKTDE--IPGNAGFLDIFLALQFVKHFIKYFGGDPSRVTVAGQVGGAA 224

  Fly   224 STHIL-MQTEQARGLFHRAIVQSGSALCAWATQPD-RKWPQRLGKELGYAGNLESEKELLEFFQQ 286
            ..|:| :.....|||||:.|..||||:.....:.| ||..|.:.|:...  .:.:.::|.....:
  Fly   225 IAHLLTLSPVVQRGLFHQVIYHSGSAIMPIFLEEDPRKHAQEIAKKADC--KMVTVRDLNTCLME 287

  Fly   287 IPASKLAQYCNSIVTQEEQRDYEILAFAPVIEPYVGDDCVIPKSQQEQLSSAWGNSIPMIIGGTS 351
            :.|.:|                 :.||.         :..:.||   .|.......|...|||.|
  Fly   288 LTALEL-----------------LTAFM---------EHALEKS---DLGIGHTGGIQFTIGGPS 323

  Fly   352 -----------FEGLFSYRTTLDDPLYMLS-AFEAIIPKQVRDAIDKEELAEMVRRLKKSYFDDP 404
                       .|..|||......|....| ....|:.......|..:|....      :|.|..
  Fly   324 GVLPKHPYDLMLETNFSYPAMGGCPKNAGSRVLNEIVDNDFEGKIPDDEYNTY------NYIDHV 382

  Fly   405 DRASMELYECLHILSIKNFWHD-IHRTLLARLAYATNLP-------------------------- 442
            .|.::...:.:.:.|...  || .:|.|:....:.|.:|                          
  Fly   383 IRQTVGTDKTMLLTSFVT--HDFFNRNLMENGTFDTLIPRLIDVAGTLNHKLPVLLALNMNNKHN 445

  Fly   443 ---TYLYRFDMDSPHFNHYRILKCGKKVR-----GVCHADDISYMF-YGILSSKLDKNSPEYRTI 498
               |:||.||. :..||.|:.:.....::     ||...|:..|:| |....::|.:  |:....
  Fly   446 PDNTFLYSFDY-AGEFNRYKEMDEETNLQSPFKAGVSLTDEALYLFPYPEHVTRLSR--PDQSMA 507

  Fly   499 ERLVGMWTSFATTGDP 514
            .|:|.:||:|..:|:|
  Fly   508 HRMVELWTNFVISGNP 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gasNP_611678.1 COesterase 28..534 CDD:278561 143/536 (27%)
Aes <117..>222 CDD:223730 44/104 (42%)
CG9287NP_609244.1 COesterase 31..558 CDD:278561 143/536 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467456
Domainoid 1 1.000 98 1.000 Domainoid score I1867
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1664
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D206516at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43142
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.