DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gas and cel.1

DIOPT Version :9

Sequence 1:NP_611678.1 Gene:gas / 37572 FlyBaseID:FBgn0034736 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_955901.2 Gene:cel.1 / 322481 ZFINID:ZDB-GENE-030131-1201 Length:550 Species:Danio rerio


Alignment Length:573 Identity:175/573 - (30%)
Similarity:261/573 - (45%) Gaps:126/573 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LGTGQTKELA---TKYGQLKGQQRRTLYDGEPYY--SFEGIPFAQPPVGELRFRAPQPPSSWQGV 86
            |||.|...|.   |:.|.::|:.|..   |...|  :|:|||||.||   .||..|.....|:||
Zfish    14 LGTAQGASLGAVLTEGGMVQGKSRSV---GLFRYMDTFKGIPFAAPP---KRFEKPVAHPGWEGV 72

  Fly    87 RDCTYAREKPMQRNSITNAAEGSEDCLYLNVYAKRLES-PKPLPVMVWIFGGGFQVGGA------ 144
            ...|..|::.:|.|.:.....|||||||||::..:..: ...|||||:|:||.|.:||.      
Zfish    73 LKTTDYRKRCLQLNLLATDVIGSEDCLYLNIWVPQGRTVSSNLPVMVFIYGGAFLLGGGQGANFL 137

  Fly   145 SRELY-GPDYFMKHDILLVTINYRVGVLGFLSLKDKELKIPGNAGLKDQIQALRWVKENIASFNG 208
            ...|| |.:...:.::::||.|||||.|||:|..|.  .||||.||.||..|:.||..||.:|.|
Zfish   138 DNYLYDGEEMADRGNVIVVTFNYRVGALGFMSTGDD--GIPGNYGLWDQHAAISWVHRNIKAFGG 200

  Fly   209 DPESITVFGESAGGASTHILMQTEQARGLFHRAIVQSGSALCAWATQPDRKWPQRLGKELGYAGN 273
            :|::||:||||||.||.:..:.|.:.:|:..|||.|||.|||.||...:   |::..:|:.....
Zfish   201 NPDNITLFGESAGAASVNFQIITPKNKGMIRRAISQSGVALCPWAISRN---PRQFAEEIATKVG 262

  Fly   274 LESEKELLEFFQQIP------ASKLAQYCNSIVTQEEQRDYEILAFAPVIEPYVGDDCVIPKSQQ 332
            ...:..:.:..::..      |.||     .:.:..:......|..:|||:   ||  .||    
Zfish   263 CPIDSGMADCLKRADPKAVTLAGKL-----KLTSSPDAPIVHNLYLSPVID---GD--FIP---- 313

  Fly   333 EQLSSAWGNS--IPMIIGGTSFEG-LFSYRTTLDDPLYMLSAFEAIIPKQVR------------- 381
            ::..:.:||:  |..|.|....:. :|:   |:|.|    |...|:....|.             
Zfish   314 DEPETLFGNAADIDYIAGVNDMDAHIFA---TIDIP----SINNALTTTPVEEVQALATALSRDR 371

  Fly   382 -----------------DAIDKEELAEMVRRLKKSY-FDDPDRASMELYECLHILSIKNFWHDIH 428
                             |..:||::.:.|..|:..| |..|.:|:  ||  ||..:.|:      
Zfish   372 GQDAGIATFQEYTVNWGDKPNKEKVKQTVVELETDYMFLVPTQAA--LY--LHTDNAKS------ 426

  Fly   429 RTLLARLAYATNLPTYLYRFDMDS--PHFNHYRILKCGKKVRGVCHADDISYMFYGILSSKLDKN 491
                ||        |:.|.|...|  |.|..:         .|..|||::.|:|....::.|. .
Zfish   427 ----AR--------TFSYLFTESSRIPVFPLW---------MGADHADELQYVFGKPFATPLG-Y 469

  Fly   492 SPEYRTIER-LVGMWTSFATTGDPN-CEIIAPVKWDPL-RPG----GVENCLN 537
            .|.:|.:.: ::..|::||.||||| .|...||.|... .||    .:.|.:|
Zfish   470 FPRHRDVSKYMIAYWSNFAQTGDPNKGESKVPVTWPEFSNPGHQYLDINNKMN 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gasNP_611678.1 COesterase 28..534 CDD:278561 172/567 (30%)
Aes <117..>222 CDD:223730 49/112 (44%)
cel.1NP_955901.2 COesterase 25..517 CDD:306613 168/555 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575557
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D206516at33208
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100080
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.650

Return to query results.
Submit another query.