DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gas and Ces2g

DIOPT Version :9

Sequence 1:NP_611678.1 Gene:gas / 37572 FlyBaseID:FBgn0034736 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001099645.1 Gene:Ces2g / 291952 RGDID:1308358 Length:560 Species:Rattus norvegicus


Alignment Length:545 Identity:159/545 - (29%)
Similarity:243/545 - (44%) Gaps:146/545 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TKYGQLKGQQRRTLYDGEPYYSFEGIPFAQPPVGELRFRAPQPPSSWQGVRDCTYAREKPMQRN- 100
            |..||::|:...:.......::|.|||||:.|||.|||..|:.|..|.||||.|      .|.| 
  Rat    38 THTGQVQGKLTHSKDFKSGVHTFLGIPFAKAPVGPLRFAPPEAPEPWSGVRDGT------SQSNI 96

  Fly   101 ---SITNAAEG-------------SEDCLYLNVYA-KRLESPKPLPVMVWIFGGGFQVGGASREL 148
               ::....||             ||||||||:|| ........|||||||.||...||.||  :
  Rat    97 CPQNVRMNMEGLKEMKLTLPPVSMSEDCLYLNIYAPAHAHEGSHLPVMVWIHGGALTVGMAS--M 159

  Fly   149 Y-GPDYFMKHDILLVTINYRVGVLGFLSLKDKELKIPGNAGLKDQIQALRWVKENIASFNGDPES 212
            | |.......|:::|||.||:|||||.|..|...:  ||.|..||:.|||||::|||.|.|:|:.
  Rat   160 YDGSMLAATEDVVVVTIQYRLGVLGFFSTGDHHAR--GNWGYLDQVAALRWVQQNIAHFGGNPDC 222

  Fly   213 ITVFGESAGGASTHILMQTEQARGLFHRAIVQSGSALCAWATQPDRKWPQRLGKELGYAGNLESE 277
            :|:|||||||.|....:.:..::|||||||::||.||                    ..|.:.:.
  Rat   223 VTIFGESAGGLSVSSHVVSPMSKGLFHRAIMESGVAL--------------------MPGTIFNF 267

  Fly   278 KELLEFFQQI----------PASKLAQYCNSIVTQEE----QRDYEILAFAPVIEPYVGDDCVIP 328
            .|::  :|.:          |.|.:  :|....::|:    .::::::       |.|.|...:|
  Rat   268 SEMV--YQMVVKLSGCEAMDPESLV--HCLRGKSEEQITVISKEFQMI-------PAVVDGEFLP 321

  Fly   329 KSQQEQLSSAWGNSIPMIIG---------------------GTSFEGLFSYRTTLDDPLYMLSAF 372
            ...||.|:||..:.:|.|||                     |.:.|.|.::   |.|     :|.
  Rat   322 NHPQELLASADFHPVPSIIGFNNDEYGWIVPKVIGSAQTIKGITRENLQAF---LKD-----TAP 378

  Fly   373 EAIIPKQVRDAIDKEELAEMVRRLKKSYFDDPDRASMELYECLHILSIKNFWHDIHRTLLARLAY 437
            :.::|.:..|.:.:|.:.::         :||.....:..|.:     ::|...|....:||. .
  Rat   379 QMMLPPECSDLLMEEYMGDI---------EDPQTLQAQFTEMM-----EDFMFVIPSLQVARF-Q 428

  Fly   438 ATNLPTYLYRF--------DMDSPHFNHYRILKCGKKVRGVCHADDISYM----FYGILSSKLDK 490
            .::.|.|.|.|        |:..||..             ..|.|::.::    |:|:   ||:.
  Rat   429 RSHAPVYFYEFQHQSSFLKDIRPPHVK-------------ADHGDEVPFVFGSFFWGM---KLNL 477

  Fly   491 NSPEYRTIERLVGMWTSFATTGDPN 515
            ...|.....|::..|.:||..|:||
  Rat   478 TEGEKLLNRRMMKYWANFARYGNPN 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gasNP_611678.1 COesterase 28..534 CDD:278561 159/545 (29%)
Aes <117..>222 CDD:223730 52/106 (49%)
Ces2gNP_001099645.1 COesterase 31..539 CDD:278561 159/545 (29%)
Aes <129..>232 CDD:223730 52/106 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336285
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100080
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.640

Return to query results.
Submit another query.