DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gas and CES4A

DIOPT Version :9

Sequence 1:NP_611678.1 Gene:gas / 37572 FlyBaseID:FBgn0034736 Length:566 Species:Drosophila melanogaster
Sequence 2:XP_011521323.1 Gene:CES4A / 283848 HGNCID:26741 Length:628 Species:Homo sapiens


Alignment Length:579 Identity:177/579 - (30%)
Similarity:270/579 - (46%) Gaps:124/579 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VVQYKLGTGQTK--ELATKYGQLKGQQRRTLYDGE-PYYSFEGIPFAQPPVGELRFRAPQPPSSW 83
            :.|..||...||  ::.||||.|:|:|   ::.|: |...|.|:||::||:|.|||..|:||..|
Human    37 MAQTALGALHTKRPQVVTKYGTLQGKQ---MHVGKTPIQVFLGVPFSRPPLGILRFAPPEPPEPW 98

  Fly    84 QGVRDCT----------------YAREKPMQRNSITNAA-------------------------- 106
            :|:||.|                .||    .|.:.|:|:                          
Human    99 KGIRDATTYPPGWSLALSPGWSAVAR----SRLTATSASRVQASLLPQPLSIWGYRCLQESWGQL 159

  Fly   107 --------------EGSEDCLYLNVYA-KRLESPKPLPVMVWIFGGGFQVGGASRELYGPDYFMK 156
                          ..||||||||||| .|......||||||..||.|.||.|| ...|.|...:
Human   160 ASMYVSTRERYKWLRFSEDCLYLNVYAPARAPGDPQLPVMVWFPGGAFIVGAAS-SYEGSDLAAR 223

  Fly   157 HDILLVTINYRVGVLGFLSLKDK--ELKIPGNAGLKDQIQALRWVKENIASFNGDPESITVFGES 219
            ..::||.:.:|:|:.|||..:.:  :....||.||.||:.|||||:||||:|.|||.::|:||:|
Human   224 EKVVLVFLQHRLGIFGFLRWRGRTDDSHARGNWGLLDQMAALRWVQENIAAFGGDPGNVTLFGQS 288

  Fly   220 AGGASTHILMQTEQARGLFHRAIVQSGSALCAWATQPDRKWPQRLGKELGY-AG-NLESEKELLE 282
            ||..|...||.:..|.|||||||.|||:||.......:   |.::.|::.: || |..|.:.|:.
Human   289 AGAMSISGLMMSPLASGLFHRAISQSGTALFRLFITSN---PLKVAKKVAHLAGCNHNSTQILVN 350

  Fly   283 FFQQIPASKLAQYCNSI--VTQEEQRDYE--ILAFAPVIEPYVGDDCVIPKSQQEQLSSAWGNSI 343
            ..:.:..:|:.:..|.:  :....|||.|  |.:.:||:     |..|||......|:....:|:
Human   351 CLRALSGTKVMRVSNKMRFLQLNFQRDPEEIIWSMSPVV-----DGVVIPDDPLVLLTQGKVSSV 410

  Fly   344 PMIIG--GTSFEGLFSYRTTLDDPLYMLSAFEAIIPKQVRDA-----IDKEELAEMVRRLKKSYF 401
            |.::|  ...|..|..|  .:..||...:..:..|.|.:...     |.||::..:|    :.|.
Human   411 PYLLGVNNLEFNWLLPY--IMKFPLNRQAMRKETITKMLWSTRTLLNITKEQVPLVV----EEYL 469

  Fly   402 DDPDRASMELYECLHILSIKNFWHDIHRTLLARLAYAT----------NLPTYLYRFDMDSPHFN 456
            |:.:....::        ::|...||.:.  |...|||          .||.|||.|:      :
Human   470 DNVNEHDWKM--------LRNRMMDIVQD--ATFVYATLQTAHYHRDAGLPVYLYEFE------H 518

  Fly   457 HYRILKCGKKVRGVCHADDISYMFYGILSSKLDKNSPEYRTIERLVGMWTSFATTGDPN 515
            |.|.:....:..|..|.|::.::|.|..::.|.....:..::: ::..|.:||.||:||
Human   519 HARGIIVKPRTDGADHGDEMYFLFGGPFATGLSMGKEKALSLQ-MMKYWANFARTGNPN 576

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gasNP_611678.1 COesterase 28..534 CDD:278561 175/573 (31%)
Aes <117..>222 CDD:223730 50/107 (47%)
CES4AXP_011521323.1 COesterase 46..613 CDD:278561 174/570 (31%)
Aes <184..>291 CDD:223730 50/107 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142748
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 216 1.000 Inparanoid score I3612
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D206516at33208
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100080
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.700

Return to query results.
Submit another query.