DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gas and Nlgn3

DIOPT Version :9

Sequence 1:NP_611678.1 Gene:gas / 37572 FlyBaseID:FBgn0034736 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_766520.2 Gene:Nlgn3 / 245537 MGIID:2444609 Length:825 Species:Mus musculus


Alignment Length:630 Identity:185/630 - (29%)
Similarity:263/630 - (41%) Gaps:192/630 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TKYGQLKGQQRRTLYDGE---PYYSFEGIPFAQPPVGELRFRAPQPPSSWQGVRDCTYAREKPMQ 98
            |.:|:|:|  .|.....|   |...:.|:|:|.||:||.||..|:||.||.|:|:.|:.  .|:.
Mouse    43 THFGKLRG--ARVPLPSEILGPVDQYLGVPYAAPPIGEKRFLPPEPPPSWSGIRNATHF--PPVC 103

  Fly    99 RNSITNAA---------------------EGSEDCLYLNVY--------AKR------------- 121
            ..:|..|.                     |.:|||||||||        ||:             
Mouse   104 PQNIHTAVPEVMLPVWFTANLDIVATYIQEPNEDCLYLNVYVPTEDGSGAKKQGEDLADNDGDED 168

  Fly   122 --LESPKPLPVMVWIFGGGFQVG------GASRELYGPDYFMKHDILLVTINYRVGVLGFLSLKD 178
              :......||||:|.||.:..|      |:....||       :::::|:|||||||||||..|
Mouse   169 EDIRDSGAKPVMVYIHGGSYMEGTGNMIDGSVLASYG-------NVIVITLNYRVGVLGFLSTGD 226

  Fly   179 KELKIPGNAGLKDQIQALRWVKENIASFNGDPESITVFGESAGGASTHILMQTEQARGLFHRAIV 243
            :..|  ||.||.|||||||||.||||.|.|||..|||||...|.:...:|..:..:.|||.|||:
Mouse   227 QAAK--GNYGLLDQIQALRWVSENIAFFGGDPRRITVFGSGIGASCVSLLTLSHHSEGLFQRAII 289

  Fly   244 QSGSALCAWAT--QPDRKWPQRLGKELGYAGNLESEKELLEFFQQIPASKLAQYCNSIVTQEEQR 306
            ||||||.:||.  || .|:...|..::|.  |:....::::..:|..|.:|       |.|:.|.
Mouse   290 QSGSALSSWAVNYQP-VKYTSLLADKVGC--NVLDTVDMVDCLRQKSAKEL-------VEQDIQP 344

  Fly   307 DYEILAFAPVIEPYVGDDCVIPKSQQEQLSSAWGNSIPMIIGGTSFEGLFSYRTTLD-------- 363
            ....:||.|||:   ||  |||...:..:......:..:::|....|||......:|        
Mouse   345 ARYHVAFGPVID---GD--VIPDDPEILMEQGEFLNYDIMLGVNQGEGLKFVEGVVDPEDGVSGT 404

  Fly   364 DPLYMLSAFEAIIPKQVRDAID--------KEELAEMVRRLKKSYFDDPDRASMEL-YECLHILS 419
            |..|.:|.|           :|        |:.|.|.:   |..|.|..||.:.|. .:.|..|.
Mouse   405 DFDYSVSNF-----------VDNLYGYPEGKDTLRETI---KFMYTDWADRDNPETRRKTLVALF 455

  Fly   420 IKNFW-------HDIHRTLLARLAYATNLPTYLYRFDMDSPHFNHYRILKCGKKVR----GVCHA 473
            ..:.|       .|:|    ||  |.:  |||.|.|      ::|     |...::    ...|.
Mouse   456 TDHQWVEPSVVTADLH----AR--YGS--PTYFYAF------YHH-----CQSLMKPAWSDAAHG 501

  Fly   474 DDISYMF-------YGILSSKLDKNSPEYRTIERLVGMWTSFATTGDPNCEIIAPVKWDPLRPGG 531
            |::.|:|       ..:......||......:  ::..||:||.|||||                
Mouse   502 DEVPYVFGVPMVGPTDLFPCNFSKNDVMLSAV--VMTYWTNFAKTGDPN---------------- 548

  Fly   532 VENCLNIADGLEFIPLPESKQF----------VVWDSFYTRESLY 566
                         .|:|:..:|          |.|..:..|:.||
Mouse   549 -------------KPVPQDTKFIHTKANRFEEVAWSKYNPRDQLY 580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gasNP_611678.1 COesterase 28..534 CDD:278561 177/586 (30%)
Aes <117..>222 CDD:223730 55/133 (41%)
Nlgn3NP_766520.2 COesterase 39..601 CDD:365897 185/630 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..172 2/20 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 622..668
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832439
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.