DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gas and Cel

DIOPT Version :9

Sequence 1:NP_611678.1 Gene:gas / 37572 FlyBaseID:FBgn0034736 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_058693.2 Gene:Cel / 24254 RGDID:2331 Length:612 Species:Rattus norvegicus


Alignment Length:551 Identity:170/551 - (30%)
Similarity:258/551 - (46%) Gaps:112/551 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KLGTGQTKELATKYGQLKGQQRR-TLYDGEPYYSFEGIPFAQPPVGELRFRAPQPPSSWQGVRDC 89
            |||.     :.|:.|.::|..:: :|..|:....|:|||||.....|    .||....|||....
  Rat    22 KLGA-----VYTEGGFVEGVNKKLSLLGGDSVDIFKGIPFATAKTLE----NPQRHPGWQGTLKA 77

  Fly    90 TYAREKPMQRNSITNAAEGSEDCLYLNVYAK--RLESPKPLPVMVWIFGGGFQVG---GAS---R 146
            |..:::.:|.....:...|.|||||||::..  |.:....|||||||:||.|.:|   ||:   .
  Rat    78 TDFKKRCLQATITQDDTYGQEDCLYLNIWVPQGRKQVSHDLPVMVWIYGGAFLMGSGQGANFLKN 142

  Fly   147 ELY-GPDYFMKHDILLVTINYRVGVLGFLSLKDKELKIPGNAGLKDQIQALRWVKENIASFNGDP 210
            .|| |.:...:.::::||.|||||.|||||..|..|  |||.||:||..|:.|||.|||:|.|||
  Rat   143 YLYDGEEIATRGNVIVVTFNYRVGPLGFLSTGDANL--PGNFGLRDQHMAIAWVKRNIAAFGGDP 205

  Fly   211 ESITVFGESAGGASTHILMQTEQARGLFHRAIVQSGSALCAWATQPDRK-WPQRLGKELG----- 269
            ::||:||||||.||..:...:...:||..|||.|||.||..||.|.:.. |.:.:.|::|     
  Rat   206 DNITIFGESAGAASVSLQTLSPYNKGLIRRAISQSGVALSPWAIQENPLFWAKTIAKKVGCPTED 270

  Fly   270 ---YAGNLE-SEKELLEFFQQIPASKLAQYCNSIVTQEEQRDYEI---LAFAPVIE-PYVGDDCV 326
               .||.|: ::...|....::|.              :.::|.|   |||.||:: .::.||.:
  Rat   271 TAKMAGCLKITDPRALTLAYRLPL--------------KSQEYPIVHYLAFIPVVDGDFIPDDPI 321

  Fly   327 IPKSQQEQLSSAWGNS--IPMIIGGTSFEG-LFSYRTTLDDPLYMLSAFEAIIPKQVRDAIDKEE 388
                      :.:.|:  |..:.|....:| ||:   |:|.|         .|.|..:| :.:|:
  Rat   322 ----------NLYDNAADIDYLAGINDMDGHLFA---TVDVP---------AIDKAKQD-VTEED 363

  Fly   389 LAEMV------RRLK----------KSYFDDPDRASMELYECLHILSIKNFWHDI------HRTL 431
            ...:|      :.||          :|:..||.:.:|:       .::..|..||      ...|
  Rat   364 FYRLVSGHTVAKGLKGTQATFDIYTESWAQDPSQENMK-------KTVVAFETDILFLIPTEMAL 421

  Fly   432 LARLAYATNLPTYLYRFDMDSPHFNHYRILKCGKKVRGVCHADDISYMFYGILSSKLDKNSPEYR 496
            ....|:|.:..||.|.       |:|...:....|..|..||||:.|:|....::.|...:.:..
  Rat   422 AQHRAHAKSAKTYSYL-------FSHPSRMPIYPKWMGADHADDLQYVFGKPFATPLGYRAQDRT 479

  Fly   497 TIERLVGMWTSFATTGDPNC-EIIAPVKWDP 526
            ..:.::..||:||.:||||. ....|..|.|
  Rat   480 VSKAMIAYWTNFAKSGDPNMGNSPVPTHWYP 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gasNP_611678.1 COesterase 28..534 CDD:278561 168/549 (31%)
Aes <117..>222 CDD:223730 56/113 (50%)
CelNP_058693.2 COesterase 26..542 CDD:278561 167/542 (31%)
Aes <118..>247 CDD:223730 68/130 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 553..612
4 X 11 AA tandem repeats, O-glycosylated region 556..599
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336388
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100080
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.640

Return to query results.
Submit another query.