DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gas and cest-12

DIOPT Version :9

Sequence 1:NP_611678.1 Gene:gas / 37572 FlyBaseID:FBgn0034736 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_499576.4 Gene:cest-12 / 176642 WormBaseID:WBGene00013540 Length:850 Species:Caenorhabditis elegans


Alignment Length:351 Identity:107/351 - (30%)
Similarity:163/351 - (46%) Gaps:55/351 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GQLKGQQ------RRTLYDGEPYYSFEGIPFAQPPVGELRFRAPQPPSSWQ-GVRDCTYAREKPM 97
            |.::|:|      :..||.|:. .:|.|||:.|.|||.||.:.|||.:.:. .:.|.||.|.|..
 Worm    42 GSVQGRQVNLGNDQSQLYSGQA-NAFTGIPYCQAPVGNLRLQPPQPLNQFNTTLHDATYFRPKCP 105

  Fly    98 QRNSITNAAEGSEDCLYLNVYAKRLESPKP-LPVMVWIFG-GGFQVGGA--SRELYGPDYFMKHD 158
            |.|:   ....:|||||||||..:..:... |.|:|.|.| .||..||.  ::|.......::..
 Worm   106 QLNA---GGPTNEDCLYLNVYTPQAGNTNANLSVLVLIDGSNGFSNGGCDQNQEKGIISNLVQRQ 167

  Fly   159 ILLVTINYRVGVLGFLSLKDKELKIPGNAGLKDQIQALRWVKENIASFNGDPESITVFGESAG-- 221
            |::||:.||:|.|||.:....  .:..|.|:.||:||:||:|..|.:|.|:|..|||.|:..|  
 Worm   168 IVVVTMQYRIGALGFFTTYTN--SVQSNLGMLDQVQAMRWIKTEIVNFGGNPNQITVAGQDDGAC 230

  Fly   222 GASTHILMQTEQARGLFHRAIVQSGSALCAW-------------ATQPDRKWPQ-RLG-KELGYA 271
            ..|.|.|  :..::.||::|||||||....:             .|.|...:.| ..| ...||.
 Worm   231 AVSAHCL--SPMSQNLFNQAIVQSGSVYSCYNPTPAVPTNPQVQVTTPRPMYDQSNTGYGNAGYQ 293

  Fly   272 GNLESEKELLEFFQQI---------PASKLAQ-YCNSIVTQEEQRDYEILAFAPVIEPYVGDDCV 326
            .|...:.:.:......         |:.:||| .||  ::.::..:.:.......::.|..|..|
 Worm   294 NNYGYQPQPITSTSSYNSANAQYDDPSQQLAQTLCN--ISPDQWNNGQTQNIQNCMKNYTVDFFV 356

  Fly   327 IPKSQQEQLSSAWGNSIPMIIGGTSF 352
              ..|....::.|     ||:..|||
 Worm   357 --NQQPGGPNATW-----MIVRDTSF 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gasNP_611678.1 COesterase 28..534 CDD:278561 107/351 (30%)
Aes <117..>222 CDD:223730 39/110 (35%)
cest-12NP_499576.4 Abhydrolase 37..>400 CDD:389770 107/351 (30%)
Abhydrolase <678..774 CDD:389770
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.