DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gas and Nlgn2

DIOPT Version :9

Sequence 1:NP_611678.1 Gene:gas / 37572 FlyBaseID:FBgn0034736 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_446444.1 Gene:Nlgn2 / 117096 RGDID:621118 Length:836 Species:Rattus norvegicus


Alignment Length:624 Identity:181/624 - (29%)
Similarity:266/624 - (42%) Gaps:158/624 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LGTGQTKE-----LATKYGQLKGQQRRTLYDGE---PYYSFEGIPFAQPPVGELRFRAPQPPSSW 83
            ||.|...|     :.|.||:::|.:|.  .:.|   |...|.|:|:|.||:|..||:.|:.|:||
  Rat    31 LGLGSLGEERFPVVNTAYGRVRGVRRE--LNNEILGPVVQFLGVPYATPPLGARRFQPPEAPASW 93

  Fly    84 QGVRDCTYAREKPMQ-------------------RNSITNAAEGSEDCLYLNVYAKRLESP---- 125
            .|||:.|.......|                   ..:.|.....||||||||:|....:.|    
  Rat    94 PGVRNATTLPPACPQNLHGALPAIMLPVWFTDNLEAAATYVQNQSEDCLYLNLYVPTEDGPLTKK 158

  Fly   126 ------KP----------LPVMVWIFGGGFQVG------GASRELYGPDYFMKHDILLVTINYRV 168
                  .|          .|||:::.||.:..|      |:....||       ::::.|:|||:
  Rat   159 RDEATLNPPDTDIRDSGKKPVMLFLHGGSYMEGTGNMFDGSVLAAYG-------NVIVATLNYRL 216

  Fly   169 GVLGFLSLKDKELKIPGNAGLKDQIQALRWVKENIASFNGDPESITVFGESAGGASTHILMQTEQ 233
            |||||||..|:..|  ||.||.||||||||:.||||.|.||||.||:||..||.:..::|:.:..
  Rat   217 GVLGFLSTGDQAAK--GNYGLLDQIQALRWLSENIAHFGGDPERITIFGSGAGASCVNLLILSHH 279

  Fly   234 ARGLFHRAIVQSGSALCAWAT--QPDRKWPQRLGKELGYAGNLESEKELLEFFQQIPASKLAQYC 296
            :.|||.:||.|||:|:.:|:.  || .|:.:.|..::|.  :.|...|.:|..::..:.:|    
  Rat   280 SEGLFQKAIAQSGTAISSWSVNYQP-LKYTRLLAAKVGC--DREDSTEAVECLRRKSSREL---- 337

  Fly   297 NSIVTQEEQRDYEILAFAPVIE-PYVGDDCVIPKSQQEQLSSAWGNSIPMIIGGTSFEGL-FSYR 359
               |.|:.|.....:||.||:: ..|.||..|...|.|.|      :..|:||....||| |...
  Rat   338 ---VDQDVQPARYHIAFGPVVDGDVVPDDPEILMQQGEFL------NYDMLIGVNQGEGLKFVED 393

  Fly   360 TTLDDPLYMLSAFEAIIPKQVRDAIDKEELAEMVRR-LKKSYFDDPDRASMELYECLHILSIKNF 423
            :...:.....|||:..:...|.:.....|..:::|. :|..|.|..||.:.|:.           
  Rat   394 SAESEDGVSASAFDFTVSNFVDNLYGYPEGKDVLRETIKFMYTDWADRDNGEMR----------- 447

  Fly   424 WHDIHRTLLARL--------AYAT-------NLPTYLYRFDMDSPHFNHYRILKCGKKVR----G 469
                .:||||..        |.||       ..|.|.|.|      ::|     |..:.|    .
  Rat   448 ----RKTLLALFTDHQWVAPAVATAKLHADYQSPVYFYTF------YHH-----CQAEGRPEWAD 497

  Fly   470 VCHADDISYMF-------YGILSSKLDKNSPEYRTIERLVGMWTSFATTGDPNCEIIAPVKWDPL 527
            ..|.|::.|:|       ..:......||......:  ::..||:||.|||||..:....|:...
  Rat   498 AAHGDELPYVFGVPMVGATDLFPCNFSKNDVMLSAV--VMTYWTNFAKTGDPNQPVPQDTKFIHT 560

  Fly   528 RPGGVENCLNIADGLEFIPLPESKQFVVWDSFYTRESLY 566
            :|...|.                   |||..|.::|..|
  Rat   561 KPNRFEE-------------------VVWSKFNSKEKQY 580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gasNP_611678.1 COesterase 28..534 CDD:278561 173/589 (29%)
Aes <117..>222 CDD:223730 51/130 (39%)
Nlgn2NP_446444.1 COesterase 42..601 CDD:395084 177/613 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 623..661
Required for interaction with LHFPL4. /evidence=ECO:0000250|UniProtKB:Q69ZK9 679..699
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 711..735
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 791..836
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336471
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.