DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gas and Ces2

DIOPT Version :9

Sequence 1:NP_611678.1 Gene:gas / 37572 FlyBaseID:FBgn0034736 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001258232.1 Gene:Ces2 / 100910144 RGDID:6504334 Length:561 Species:Rattus norvegicus


Alignment Length:573 Identity:174/573 - (30%)
Similarity:256/573 - (44%) Gaps:137/573 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TKYGQLKGQQRRTLYDGEPYYSFEGIPFAQPPVGELRFRAPQPPSSWQGVRDCTYAREKPMQR-- 99
            |..||::|:...........::|.|||||:||||.|||..|:||..|.||||.|......:|.  
  Rat    38 THTGQVQGKLDHVKDTKAGVHTFLGIPFAKPPVGPLRFAPPEPPEPWSGVRDATSQPAMCLQNLD 102

  Fly   100 ----------NSITNAAEGSEDCLYLNVYA-KRLESPKPLPVMVWIFGGGFQVGGASRELY-GPD 152
                      ..|.::...||||||||||| ........|||||||.||...||.||  :| |..
  Rat   103 ILDEVGLLDMKMILSSISMSEDCLYLNVYAPAHAREGSNLPVMVWIHGGALVVGMAS--MYDGSL 165

  Fly   153 YFMKHDILLVTINYRVGVLGFLSLKDKELKIPGNAGLKDQIQALRWVKENIASFNGDPESITVFG 217
            ..:..|:::|||.||:|||||.|..|:..:  ||.|..||:.|||||::|||.|.|:|..:|:||
  Rat   166 LTVNEDLVVVTIQYRLGVLGFFSTGDEHAR--GNWGYLDQVAALRWVQQNIAHFGGNPNRVTIFG 228

  Fly   218 ESAGG--ASTHILMQTEQARGLFHRAIVQSGSALCAWATQPDRKWPQRLGKELGYAGNLESEKEL 280
            |||||  .|:|::  :..::||||.||::||.||.     ||                      |
  Rat   229 ESAGGTSVSSHVI--SPMSQGLFHGAIMESGVALL-----PD----------------------L 264

  Fly   281 LEFFQQIPASKLAQY--CNSIVTQ------EEQRDYEILAFAPVIE--PYVGDDCVIPKSQQEQL 335
            :....:..::.:|:.  |.::.::      ..:...|||....|.:  |.|.|...:|:..:|.|
  Rat   265 ISETSETVSTTVAKLSGCEAMDSEALVRCLRAKSGAEILVINKVFKMIPAVVDGEFLPRHPKELL 329

  Fly   336 SSAWGNSIPMIIGGTSFEGLFSYRTTLDDPLYMLSAFEAIIPKQVRD---AIDKEELAEMV---- 393
            :|...:.:|.|||..:.|    |..|:  |:.|.:|  .||.:..|:   |:.|:..|:|:    
  Rat   330 ASEDFHPVPSIIGVNTDE----YCCTI--PMVMGTA--QIIKELSRENLQAVLKDTAAQMMLPPE 386

  Fly   394 --RRLKKSYF---DDPDRASMELYE-------CLHILSIKNFWHDIHRTLLARLAYATNLPTYLY 446
              ..|.:.|.   ||.....::..|       .:..|.:.:|             ..::.|.|.|
  Rat   387 CGDLLMEEYMGNTDDSQTLQIQYTEMMGDFLFVIPALQVAHF-------------QRSHAPVYFY 438

  Fly   447 RFDMDSPHFNHYRILKCGKKVR----GVCHADDISYMFYGILSS-KLDKNSPEYRTIERLVGMWT 506
            .|.....:|         |.||    ...|||::.::|....|. |||....|.....|::..|.
  Rat   439 EFQHAPSYF---------KNVRPPHVKADHADEVPFVFGSFFSGMKLDFTEEERLLSRRMMKYWA 494

  Fly   507 SFATTGDPNCEIIAPVKWDPLRPGGVENCLNIADGLEFIP-LPESKQFVVWDS 558
            :||..|:||.|                       ||.:.| |...:|::..|:
  Rat   495 NFARQGNPNSE-----------------------GLPYWPALDHDEQYLQLDT 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gasNP_611678.1 COesterase 28..534 CDD:278561 168/546 (31%)
Aes <117..>222 CDD:223730 53/106 (50%)
Ces2NP_001258232.1 COesterase 31..540 CDD:278561 174/573 (30%)
Aes <130..>233 CDD:223730 53/106 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336353
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.