DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gas and bche

DIOPT Version :9

Sequence 1:NP_611678.1 Gene:gas / 37572 FlyBaseID:FBgn0034736 Length:566 Species:Drosophila melanogaster
Sequence 2:XP_002931610.1 Gene:bche / 100495889 XenbaseID:XB-GENE-980117 Length:602 Species:Xenopus tropicalis


Alignment Length:591 Identity:171/591 - (28%)
Similarity:259/591 - (43%) Gaps:120/591 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GQTKELATKYGQLKGQQRRTLYDGEPYYSFEGIPFAQPPVGELRFRAPQPPSSWQGVRDCT-YAR 93
            |:|..:.||||::.|.| .:::.| ...:|.|||:|:||:|:|||:.|.|...|..:.:.: |..
 Frog    28 GETDIVDTKYGKVTGVQ-ISVFSG-IITAFLGIPYAEPPIGDLRFKKPVPHKPWSEIWNASQYGN 90

  Fly    94 EKPMQRNSITNAAEG----------SEDCLYLNVYAKRLESPKP--LPVMVWIFGGGFQVGGASR 146
            ......:.|.....|          ||||||||::   :.:|||  ..|||||:||.|:.|.:|.
 Frog    91 SCYQTVDQIFPGFSGAEMWNPNTQLSEDCLYLNIW---IPTPKPRNASVMVWIYGGSFETGTSSL 152

  Fly   147 ELYGPDYFMKHD-ILLVTINYRVGVLGFLSLKDKELKIPGNAGLKDQIQALRWVKENIASFNGDP 210
            :||...:..:.: :::|::|||:|.||||:..... :.|||.||.||..||:||.||||:|.|:|
 Frog   153 DLYDGKFLARTERVIVVSMNYRLGALGFLAFPGNN-EAPGNVGLFDQRLALQWVYENIAAFGGNP 216

  Fly   211 ESITVFGESAGGASTHILMQTEQARGLFHRAIVQSGSALCAWA--TQPDRKWPQRLGKELGYAGN 273
            :|||:|||||||||....|.:.::.|.|.|||:||.:|...||  |:.:..     .:.|..|  
 Frog   217 KSITIFGESAGGASVSYHMLSPKSHGFFTRAIMQSATANAPWAVITKAEAS-----NRALTLA-- 274

  Fly   274 LESEKELLEFFQQIPASKLAQYCNSIVTQEEQRDYEILAFAPVIE----PYVGDDCVI--PK--S 330
                 .||..|.:.....:|...|....:..::...:|....|||    |.|..|.:|  |:  .
 Frog   275 -----NLLNCFYRNETEIIACLRNKSPEEIFEKAVSVLPHRSVIEVNFPPTVDGDFLIEMPEILM 334

  Fly   331 QQEQLSSAWGNSIPMIIGGTSFEGLFSYRTTLDDPLYMLSAF----EAII-----PKQVRDAIDK 386
            |..||.    ....::.|....||.:..       :|.|..|    |:.|     .|.|:.|..|
 Frog   335 QLGQLK----KKTQILTGVNKDEGSYFL-------VYGLPGFSKDHESFINRTQFHKSVKLAFPK 388

  Fly   387 -EELAEMVRRLKKSYFDDPDRASMELYECLHILSIKNF---------WHDIHRTLLARLAYATNL 441
             .|||........:.::|....|........|:...||         |:.         ....| 
 Frog   389 ATELAIDSVLFHYTNWEDEQNPSHNRDAMDDIVGDYNFICPLLEFTKWNS---------ELGNN- 443

  Fly   442 PTYLYRFDMDSPHFNHYRILKCGKKV-----RGVCHADDISYMFYGILSSKLDKNSPEYRTIERL 501
             .|||.|        |:|    ..|:     .||.|..:|.::|...:..:|:....|......|
 Frog   444 -AYLYYF--------HHR----SSKLTWPGWMGVMHGYEIEFVFGIPMYRRLNYTKAEETLSRTL 495

  Fly   502 VGMWTSFATTGDPNCEIIAPVKWDPLRPGGVENCLNIADGLEFIPL----------PESKQFVVW 556
            :..|.:||.||:||....:..:|.          :...|...::.|          ..:||...|
 Frog   496 MRYWANFAKTGNPNGAQSSENRWP----------VFTLDEQHYLMLGTEDSKTNRKMRAKQCRFW 550

  Fly   557 DSFYTR 562
            ::||.:
 Frog   551 NNFYPK 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gasNP_611678.1 COesterase 28..534 CDD:278561 164/551 (30%)
Aes <117..>222 CDD:223730 50/107 (47%)
bcheXP_002931610.1 COesterase 32..550 CDD:365897 166/579 (29%)
AChE_tetra 565..599 CDD:370053
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.