DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gas and cel.2

DIOPT Version :9

Sequence 1:NP_611678.1 Gene:gas / 37572 FlyBaseID:FBgn0034736 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001120027.1 Gene:cel.2 / 100144991 XenbaseID:XB-GENE-1217488 Length:552 Species:Xenopus tropicalis


Alignment Length:503 Identity:172/503 - (34%)
Similarity:235/503 - (46%) Gaps:81/503 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 FEGIPFAQPPVGELRFRAPQPPSSWQGVRDCTYAREKPMQRNSITNAAEGSEDCLYLNVYAKRLE 123
            |:|||||.||   ..|...:....|.|.......:.:.:|.....:...||.|||||||:..:..
 Frog    50 FKGIPFAAPP---KPFEKAEKHPGWSGTLQAKDYKPRCLQATITQDNVFGSLDCLYLNVWVPQTR 111

  Fly   124 S--PKPLPVMVWIFGGGFQVG---GA---SRELY-GPDYFMKHDILLVTINYRVGVLGFLSLKDK 179
            |  ...||||||||||||.:|   ||   |..|| |.:..|:..:::||.|||||.|||||..|.
 Frog   112 SQVSTNLPVMVWIFGGGFLLGSGQGANFLSNYLYDGEEVAMRGKVIVVTFNYRVGPLGFLSTGDS 176

  Fly   180 ELKIPGNAGLKDQIQALRWVKENIASFNGDPESITVFGESAGGASTHILMQTEQARGLFHRAIVQ 244
              ..|||.||.||..|:.|||.|||:|.|||.:||:|||||||||..:...|....||..|||.|
 Frog   177 --NAPGNYGLWDQHMAIAWVKRNIAAFGGDPNNITLFGESAGGASVSLQTLTPYNVGLIKRAISQ 239

  Fly   245 SGSALCAWATQPD-RKWPQRLGKELGYAGNLESEKELLEFFQQI-PASKLAQYCNSIVTQEEQRD 307
            ||..||.||.|.| ..|.:.|..:||...|  :.|||.:..:.. |.:....|...:...|    
 Frog   240 SGVGLCPWAIQRDPLTWAKSLASKLGCPVN--NTKELADCLRNTDPGALTIAYQLQLFNLE---- 298

  Fly   308 YEI---LAFAPVIEPYVGDDCVIPKSQQEQLSSAWGNSIPMIIGGTSFEG-LFS--YRTTLDDPL 366
            |.:   ||::|||:   ||  .||...:...|:|.|  :..|.|..:.:| ||:  ....::.||
 Frog   299 YPLVHYLAYSPVID---GD--FIPDEPRNLFSNAAG--VDYIAGVNNMDGHLFAGVDLPAINQPL 356

  Fly   367 YMLSAFEAIIPKQVRDAIDKEELAEMVRRLKKSY------------FDDPDRASMELYECLHILS 419
            :.:|.      :||:..:....||:.|..|..:|            .:|..|..:|: |..:|..
 Frog   357 HKIST------EQVQKVVRGLTLAKGVPALDIAYDLYTAGWGTNPSQEDMKRTVVEV-ETDYIFL 414

  Fly   420 IKNFWHDIHRTLLARLAYATNLPTYLYRFDMDS--PHFNHYRILKCGKKVRGVCHADDISYMFYG 482
            :..     ...|......|....||.|.|...|  |.:..:         .|..||:|:.:||..
 Frog   415 VAT-----QEALALHYQNAKGAKTYSYMFSHPSRMPVYPSW---------MGADHAEDLQFMFGK 465

  Fly   483 ILSSKL-----DKNSPEYRTIERLVGMWTSFATTGDPN-CEIIAPVKW 524
            ..|:.|     |::..:|     ::..||:||.||||: .|...|..|
 Frog   466 PFSTPLAYRPRDRDVAQY-----MIAYWTNFAATGDPSKGESSIPTPW 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gasNP_611678.1 COesterase 28..534 CDD:278561 172/503 (34%)
Aes <117..>222 CDD:223730 60/113 (53%)
cel.2NP_001120027.1 COesterase 24..542 CDD:365897 172/503 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.