DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4610 and AT1G22200

DIOPT Version :10

Sequence 1:NP_611677.1 Gene:CG4610 / 37571 FlyBaseID:FBgn0034735 Length:661 Species:Drosophila melanogaster
Sequence 2:NP_564162.1 Gene:AT1G22200 / 838825 AraportID:AT1G22200 Length:386 Species:Arabidopsis thaliana


Alignment Length:117 Identity:28/117 - (23%)
Similarity:44/117 - (37%) Gaps:27/117 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RSAHSAGADIYDVVVIGGGHAGTEASAAAARMGSRTLLLTHKLETIGEMSCNPSFGGIGKGHLMR 85
            |...|:| ::.:....|.||  |:......:.|.|   |.|     .|..|...||         
plant   107 RRLDSSG-NVIEAKQDGIGH--TKIEKPLQKHGGR---LEH-----NETYCGSCFG--------- 151

  Fly    86 EVDALDGVCARCCDVSGVHYKVLNRRRGPAVWGPRA--QIDRQLYKKAVQQE 135
             .:|.|..|...|:.....|    |::|.|:..|.:  |..|:.:.:.|:.|
plant   152 -AEASDDACCNSCEEVREAY----RKKGWALSDPESIDQCKREGFVQKVKDE 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4610NP_611677.1 MnmG 28..661 CDD:440214 25/110 (23%)
AT1G22200NP_564162.1 ERGIC_N 8..98 CDD:464000
COPIIcoated_ERV 149..366 CDD:462327 15/64 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.