DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4610 and Ergic1

DIOPT Version :10

Sequence 1:NP_611677.1 Gene:CG4610 / 37571 FlyBaseID:FBgn0034735 Length:661 Species:Drosophila melanogaster
Sequence 2:XP_036016643.1 Gene:Ergic1 / 67458 MGIID:1914708 Length:308 Species:Mus musculus


Alignment Length:86 Identity:19/86 - (22%)
Similarity:39/86 - (45%) Gaps:12/86 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   399 ILLSDD--SDGVFEEIDLTEVGRTVENIKKERQDAIKKEIVDSLTNDDMDEIYLIDDDYDDELAD 461
            ::|..|  .:||.||.:...:|..:..||...::   |:.  ::|......:|.:     .:..:
Mouse    97 LVLDKDMAEEGVLEEAEFYNIGPLIRIIKDRMEE---KDY--TVTQVPPKHVYRV-----LQCQE 151

  Fly   462 EELSSIDDTLLDRSVIDELFN 482
            |||:.:..|:.|....::|.|
Mouse   152 EELTQMVSTMSDGWRFEQLVN 172

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG4610NP_611677.1 MnmG 28..661 CDD:440214 19/86 (22%)