DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4610 and ergi-2

DIOPT Version :10

Sequence 1:NP_611677.1 Gene:CG4610 / 37571 FlyBaseID:FBgn0034735 Length:661 Species:Drosophila melanogaster
Sequence 2:NP_510494.2 Gene:ergi-2 / 181597 WormBaseID:WBGene00007668 Length:428 Species:Caenorhabditis elegans


Alignment Length:117 Identity:25/117 - (21%)
Similarity:44/117 - (37%) Gaps:33/117 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   525 LNLPKAKASVEKSAFDMLGIPADNITIEQLIHLHP--------NELSWL-----------KGERN 570
            :|.|.:...|..|:.:..|  .|.: :.|.|..:|        .::.|.           ||.|.
 Worm    89 INTPCSILQVVSSSDEYSG--GDGL-LRQTIQKNPTRFDFTDEEQMYWTILRHAHDQYNKKGLRA 150

  Fly   571 LAERLKIEALYSFFVDEQQRDVEDVRREERLSIPADIDYFSKSLSLSNEERQ 622
            |.|       ..:..|:.:.::|.:..|::....|.|    |.|.|.|::.|
 Worm   151 LEE-------LEYVDDDIETNLEHLANEKQDEEAAHI----KELRLKNKKTQ 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4610NP_611677.1 MnmG 28..661 CDD:440214 25/117 (21%)
ergi-2NP_510494.2 COPIIcoated_ERV <226..380 CDD:462327
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.