DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4610 and LOC1280532

DIOPT Version :10

Sequence 1:NP_611677.1 Gene:CG4610 / 37571 FlyBaseID:FBgn0034735 Length:661 Species:Drosophila melanogaster
Sequence 2:XP_320382.3 Gene:LOC1280532 / 1280532 VectorBaseID:AGAMI1_010346 Length:386 Species:Anopheles gambiae


Alignment Length:97 Identity:19/97 - (19%)
Similarity:39/97 - (40%) Gaps:28/97 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   533 SVEKSAFDMLGIPADNITIEQLIHLHPNELSWLKGERNLAERLKIEALYSFFVDEQQRDVEDVRR 597
            ::.:.:.|.:.:.|.:.|.||.:|:..|                   :|...:|.|...:|:.::
Mosquito    75 TIPRISCDYVSLDAQDSTGEQHLHIEHN-------------------IYKRRLDLQGNQIEEPKK 120

  Fly   598 EERLSIPADIDYFSKSLSLSNEERQKLTLIQP 629
            |       ||...:|  .:|:.|....|.::|
Mosquito   121 E-------DIQASTK--RISSTEAPATTTVKP 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4610NP_611677.1 MnmG 28..661 CDD:440214 19/97 (20%)
LOC1280532XP_320382.3 ERGIC_N 7..97 CDD:464000 5/21 (24%)
COPIIcoated_ERV 148..366 CDD:462327
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.