DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4554 and AT2G32580

DIOPT Version :10

Sequence 1:NP_611676.1 Gene:CG4554 / 37570 FlyBaseID:FBgn0034734 Length:2733 Species:Drosophila melanogaster
Sequence 2:NP_565746.1 Gene:AT2G32580 / 817818 AraportID:AT2G32580 Length:183 Species:Arabidopsis thaliana


Alignment Length:106 Identity:26/106 - (24%)
Similarity:47/106 - (44%) Gaps:16/106 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  2603 LLSVESVTRLAPSLLQALVREMSEEDQNVDAELRQQALRVGSRLRKRIGAEVYDKLRNAVQTKLM 2667
            ||:.|...|.|.|:         |:.:.||..| .:|.::.|..:|..     ||..:.::|...
plant    88 LLTEELKQREAASM---------EKHKRVDTGL-LEAKKITSSYQKEA-----DKCNSGMETCEE 137

  Fly  2668 ARRAERRKVVAQEKIHDP-ERAAKRKAGMQERKKAAKRLKA 2707
            ||....:.:|.|:|:... |:.|::|.......|:..:.|:
plant   138 AREKAEKALVEQKKLTSMWEQRARQKGYKDGATKSTVKSKS 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4554NP_611676.1 DRIM 840..1446 CDD:462198
FYDLN_acid <1606..1667 CDD:450301
DUF6700 1723..1944 CDD:466565
AT2G32580NP_565746.1 DUF1068 5..168 CDD:399393 24/94 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.