DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10384 and QKI

DIOPT Version :9

Sequence 1:	NP_001163254.2	Gene:	CG10384 / 37567	FlyBaseID:	FBgn0034731	Length:	492	Species:	Drosophila melanogaster
Sequence 2:	NP_006766.1	Gene:	QKI / 9444	HGNCID:	21100	Length:	341	Species:	Homo sapiens

Alignment Length:	142	Identity:	59/142 - (41%)
Similarity:	90/142 - (63%)	Gaps:	13/142 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly    32 VKVAVKVAVPVRDHPKFNFVGKLLGPKGNSMKRLQEDTMCKMAVLGRGSMRDRRKEEELRGSGDS 96
            |::..|:.|||:::|.|||||::|||:|.:.|:|:.:|.||:.|.|:|||||::|||:.||.  .
Human    80 VQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGK--P 142

  Fly    97 RYAHLFEDLHVEISTFAAPAEAHARIAYALAEVRRFLVP--DYHDDIRQEQMWEMQALTST---- 155
            .:.||.|||||.|:...|...|..::..|:.||::.|||  :..|.:::.|:.|:..|..|
Human   143 NWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDA 207

  Fly   156 ----PALGAHSL 163
                ||| |.||
Human   208 NIKSPAL-AFSL 218

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10384	NP_001163254.2	SF1_like-KH	44..155	CDD:239088	47/112 (42%)
QKI	NP_006766.1	STAR_dimer	10..66	CDD:406848
		Qua1 domain, involved in homodimerization. /evidence=ECO:0000250\|UniProtKB:Q17339	11..82		1/1 (100%)
		KH-I_Hqk	81..183	CDD:411893	47/103 (46%)
		Qua2 domain, involved in RNA binding. /evidence=ECO:0000269\|PubMed:23630077	182..213		5/30 (17%)
		PHA03247	<211..314	CDD:223021	6/9 (67%)
		SH3-binding	276..279
		Quaking_NLS	312..341	CDD:406855
		Nuclear localization signal. /evidence=ECO:0000250	324..330
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165155044
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.840