DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10384 and AT1G09660

DIOPT Version :9

Sequence 1:NP_001163254.2 Gene:CG10384 / 37567 FlyBaseID:FBgn0034731 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001320903.1 Gene:AT1G09660 / 837494 AraportID:AT1G09660 Length:298 Species:Arabidopsis thaliana


Alignment Length:143 Identity:53/143 - (37%)
Similarity:86/143 - (60%) Gaps:10/143 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VKVAVKVAVPVRDHPKFNFVGKLLGPKGNSMKRLQEDTMCKMAVLGRGSMRDRRKEEELRGSGDS 96
            ||..:::.|||..:|.:||||::|||:|||:||::..|.|::.:.||||::|..|||:|:|.  .
plant   145 VKKVIRLDVPVDKYPSYNFVGRILGPRGNSLKRVELATHCRVFIRGRGSVKDTVKEEKLKGK--P 207

  Fly    97 RYAHLFEDLHVEISTFAAPAEAHARIAYALAEVRRFLVP--DYHDDIRQEQMWEMQALTSTPALG 159
            .|.||.|.|||.|.........::|:.:|:..:...|.|  :..|..::||:.|:.||..|    
plant   208 GYEHLCEPLHVLIEAELPEDIINSRLEHAVHFLESLLKPMDESMDHYKREQLKELAALNGT---- 268

  Fly   160 AHSLEDSHSPTIN 172
              ..|:|.||:::
plant   269 --LREESPSPSLS 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10384NP_001163254.2 SF1_like-KH 44..155 CDD:239088 43/112 (38%)
AT1G09660NP_001320903.1 STAR_dimer 45..90 CDD:406848
KH-I 146..246 CDD:412160 40/101 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.