DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10384 and AT5G56140

DIOPT Version :9

Sequence 1:NP_001163254.2 Gene:CG10384 / 37567 FlyBaseID:FBgn0034731 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_200425.1 Gene:AT5G56140 / 835713 AraportID:AT5G56140 Length:315 Species:Arabidopsis thaliana


Alignment Length:146 Identity:55/146 - (37%)
Similarity:82/146 - (56%) Gaps:13/146 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KVAVKVAVPVRDHPKFNFVGKLLGPKGNSMKRLQEDTMCKMAVLGRGSMRDRRKEEELRGSGDSR 97
            |..::|.:||.::|.|||||:||||:|||:||::..|.|::.:.||||::|..|||.:||.  ..
plant   165 KRTIRVDIPVDNYPNFNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDPIKEEMMRGK--PG 227

  Fly    98 YAHLFEDLHVEISTFAAPAE-AHARIAYALAEVRRFLVP--DYHDDIRQEQMWEMQALTSTPALG 159
            |.||.|.||:.:.. ..|.| ..||:..|...:...|.|  :.||..:::|:.|:..|..|    
plant   228 YEHLNEPLHILVEA-ELPIEIVDARLMQAREILDDLLTPMEETHDMYKKQQLRELALLNGT---- 287

  Fly   160 AHSLEDSHSPTINSSS 175
               |.:..||...|.|
plant   288 ---LREEGSPMSGSVS 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10384NP_001163254.2 SF1_like-KH 44..155 CDD:239088 45/113 (40%)
AT5G56140NP_200425.1 STAR_dimer 65..>97 CDD:406848
KH-I 165..265 CDD:412160 43/102 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.