DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10384 and AT5G56140

DIOPT Version :10

Sequence 1:NP_611673.3 Gene:CG10384 / 37567 FlyBaseID:FBgn0034731 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_200425.1 Gene:AT5G56140 / 835713 AraportID:AT5G56140 Length:315 Species:Arabidopsis thaliana


Alignment Length:146 Identity:55/146 - (37%)
Similarity:82/146 - (56%) Gaps:13/146 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KVAVKVAVPVRDHPKFNFVGKLLGPKGNSMKRLQEDTMCKMAVLGRGSMRDRRKEEELRGSGDSR 97
            |..::|.:||.::|.|||||:||||:|||:||::..|.|::.:.||||::|..|||.:||.  ..
plant   165 KRTIRVDIPVDNYPNFNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDPIKEEMMRGK--PG 227

  Fly    98 YAHLFEDLHVEISTFAAPAE-AHARIAYALAEVRRFLVP--DYHDDIRQEQMWEMQALTSTPALG 159
            |.||.|.||:.:.. ..|.| ..||:..|...:...|.|  :.||..:::|:.|:..|..|    
plant   228 YEHLNEPLHILVEA-ELPIEIVDARLMQAREILDDLLTPMEETHDMYKKQQLRELALLNGT---- 287

  Fly   160 AHSLEDSHSPTINSSS 175
               |.:..||...|.|
plant   288 ---LREEGSPMSGSVS 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10384NP_611673.3 KH-I_KHDRBS 43..131 CDD:411812 38/88 (43%)
AT5G56140NP_200425.1 STAR_dimer 65..>97 CDD:435414
KH-I 165..265 CDD:469614 43/102 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.