DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10384 and AT3G08620

DIOPT Version :9

Sequence 1:NP_001163254.2 Gene:CG10384 / 37567 FlyBaseID:FBgn0034731 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_187474.2 Gene:AT3G08620 / 820009 AraportID:AT3G08620 Length:283 Species:Arabidopsis thaliana


Alignment Length:163 Identity:54/163 - (33%)
Similarity:88/163 - (53%) Gaps:13/163 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PVKVAVKVAVPVRDHPKFNFVGKLLGPKGNSMKRLQEDTMCKMAVLGRGSMRDRRKEEELRGSGD 95
            |||..:::.:||..:|.|||||:||||:|||:||::..|.|::.:.|:||::|..|||:|:|.  
plant   132 PVKRILRLDLPVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPEKEEKLKGK-- 194

  Fly    96 SRYAHLFEDLHVEISTFAAPAEAHARIAYALAEVRRFLVP--DYHDDIRQEQMWEMQALTSTPAL 158
            ..|.||.|.||:.|...........::..|...:...:.|  :..|.|:::|:.|:..|.|    
plant   195 PGYEHLNEQLHILIEADLPIDIVDIKLRQAQEIIEELVKPVDESQDYIKRQQLRELALLNS---- 255

  Fly   159 GAHSLEDSHSPTINSSSQVGGTTNSSSNGASGR 191
              :..|:|..|   |.|.....:|:.....:||
plant   256 --NLRENSPGP---SGSVSPFNSNAMKRPKTGR 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10384NP_001163254.2 SF1_like-KH 44..155 CDD:239088 40/112 (36%)
AT3G08620NP_187474.2 STAR_dimer 28..74 CDD:406848
KH-I 134..234 CDD:412160 37/101 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.