DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10384 and khdrbs2

DIOPT Version :9

Sequence 1:NP_001163254.2 Gene:CG10384 / 37567 FlyBaseID:FBgn0034731 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001072215.1 Gene:khdrbs2 / 779662 XenbaseID:XB-GENE-490722 Length:345 Species:Xenopus tropicalis


Alignment Length:182 Identity:83/182 - (45%)
Similarity:121/182 - (66%) Gaps:25/182 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ERSLKGSEKLKMLDITRDKPVKVAVKVAVPVRDHPKFNFVGKLLGPKGNSMKRLQEDTMCKMAVL 76
            |.:.:..|| |.|||..:|.:|::.:|.:||:.:||||||||||||:|||:|||||:|..||::|
 Frog    39 EGNKEDGEK-KYLDIISNKNIKLSERVLIPVKQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSIL 102

  Fly    77 GRGSMRDRRKEEELRGSGDSRYAHLFEDLHVEISTFAAPAEAHARIAYALAEVRRFLVPDYHDDI 141
            |:|||||:.||||||.|.::::|||.::|||.:..||.|.||::|:::||.|:::||||||:|:|
 Frog   103 GKGSMRDKIKEEELRKSDEAKHAHLSDELHVLLEVFAPPGEAYSRMSHALEEIKKFLVPDYNDEI 167

  Fly   142 RQEQMWEMQALTSTPALGAHSLEDSHSPTINSSSQVGGTTNSSSNGASGRGL 193
            ||||:.|:..|.                        |...:....|..|||:
 Frog   168 RQEQLRELSYLN------------------------GSDDSERGKGTRGRGI 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10384NP_001163254.2 SF1_like-KH 44..155 CDD:239088 66/110 (60%)
khdrbs2NP_001072215.1 Qua1 5..57 CDD:374463 7/18 (39%)
SF1_like-KH 61..180 CDD:239088 69/142 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..224 6/42 (14%)
Sam68-YY 263..317 CDD:374636
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 321..345
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.