DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10384 and Khdrbs3

DIOPT Version :9

Sequence 1:NP_001163254.2 Gene:CG10384 / 37567 FlyBaseID:FBgn0034731 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_071585.2 Gene:Khdrbs3 / 64015 RGDID:620921 Length:346 Species:Rattus norvegicus


Alignment Length:186 Identity:90/186 - (48%)
Similarity:126/186 - (67%) Gaps:11/186 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ERSLKGSEK--LKMLDITRDKPVKVAVKVAVPVRDHPKFNFVGKLLGPKGNSMKRLQEDTMCKMA 74
            |:..||..|  .|.:|:..:|.:|:..||.:||:..||||||||||||:|||:|||||:|:.||:
  Rat    32 EKFQKGEAKDEEKYIDVVINKNMKLGQKVLIPVKQFPKFNFVGKLLGPRGNSLKRLQEETLTKMS 96

  Fly    75 VLGRGSMRDRRKEEELRGSGDSRYAHLFEDLHVEISTFAAPAEAHARIAYALAEVRRFLVPDYHD 139
            :||:|||||:.||||||.||:::|.||.:||||.|..||.||||:||:.:||.|:::||:|||:|
  Rat    97 ILGKGSMRDKAKEEELRKSGEAKYFHLNDDLHVLIEVFAPPAEAYARMGHALEEIKKFLIPDYND 161

  Fly   140 DIRQEQMWEMQALTSTPALGAHSLEDSHSPTINSSSQVGGTTNSSSNGASGRGLGG 195
            :|||.|:.|:..|..       ..|::..|.:...|.:  .|...:..|..||.||
  Rat   162 EIRQAQLQELTYLNG-------GSENADVPVVRGKSTL--RTRGVTTPAITRGRGG 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10384NP_001163254.2 SF1_like-KH 44..155 CDD:239088 69/110 (63%)
Khdrbs3NP_071585.2 Involved in homodimerization. /evidence=ECO:0000250|UniProtKB:O75525 1..160 73/127 (57%)
Qua1 4..53 CDD:406639 6/20 (30%)
KH-I_KHDRBS3 48..160 CDD:411898 67/111 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..268
Sam68-YY 266..320 CDD:406871
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 320..346
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348926
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.