DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10384 and Qk

DIOPT Version :9

Sequence 1:NP_001163254.2 Gene:CG10384 / 37567 FlyBaseID:FBgn0034731 Length:492 Species:Drosophila melanogaster
Sequence 2:XP_038942853.1 Gene:Qk / 499022 RGDID:1584886 Length:341 Species:Rattus norvegicus


Alignment Length:142 Identity:59/142 - (41%)
Similarity:90/142 - (63%) Gaps:13/142 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VKVAVKVAVPVRDHPKFNFVGKLLGPKGNSMKRLQEDTMCKMAVLGRGSMRDRRKEEELRGSGDS 96
            |::..|:.|||:::|.|||||::|||:|.:.|:|:.:|.||:.|.|:|||||::|||:.||.  .
  Rat    80 VQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGK--P 142

  Fly    97 RYAHLFEDLHVEISTFAAPAEAHARIAYALAEVRRFLVP--DYHDDIRQEQMWEMQALTST---- 155
            .:.||.|||||.|:...|...|..::..|:.||::.|||  :..|.:::.|:.|:..|..|    
  Rat   143 NWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDA 207

  Fly   156 ----PALGAHSL 163
                ||| |.||
  Rat   208 NIKSPAL-AFSL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10384NP_001163254.2 SF1_like-KH 44..155 CDD:239088 47/112 (42%)
QkXP_038942853.1 STAR_dimer 10..66 CDD:406848
KH-I_Hqk 81..183 CDD:411893 47/103 (46%)
PHA03247 <211..314 CDD:223021 6/9 (67%)
Quaking_NLS 312..341 CDD:406855
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348918
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.