DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10384 and SF1

DIOPT Version :9

Sequence 1:NP_001163254.2 Gene:CG10384 / 37567 FlyBaseID:FBgn0034731 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_524654.2 Gene:SF1 / 43912 FlyBaseID:FBgn0025571 Length:787 Species:Drosophila melanogaster


Alignment Length:394 Identity:102/394 - (25%)
Similarity:150/394 - (38%) Gaps:77/394 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KP--VKVAVKVAVPVRDHPKFNFVGKLLGPKGNSMKRLQEDTMCKMAVLGRGSMRD----RRKEE 88
            ||  .:|:.||.:|...||..||||.|:||:||::|.:::||..|:.:.|:||:::    |:..:
  Fly   385 KPPVTRVSDKVLIPQEQHPDINFVGLLIGPRGNTLKAMEKDTGAKIIIRGKGSVKEGKVGRKDGQ 449

  Fly    89 ELRGSGDSRYAHLFEDLHVEISTFAAPAEAHARIAYALAEVRR--FLVPDYHDDIRQEQMWEMQA 151
            .|.|..        |.||..|:  |...||..:....:.:|.|  ..||:.|:|:|:.|:.|:..
  Fly   450 PLPGED--------EPLHAFIT--APNPEAVRKAVDKIKDVIRQGIEVPEGHNDLRRMQLRELAQ 504

  Fly   152 LTSTPALGAHSLE-------DSHSPTINSSSQVGGTTNSSSNGASGRGLGGGLADMDTSNDDKSD 209
            |..|  |..:.::       |..|........:..|...:|.|      |.|....|..|.....
  Fly   505 LNGT--LRENDIQRCTCGSTDHKSWQCPDKPIITNTIVCTSCG------GTGHLTKDCRNKRPGS 561

  Fly   210 DASGMECLSAVDKLD--CSSSCASLGISGITTISTTSPEHPHPHQHHQQHQQHQQHHAHLHPAH- 271
            ...||.|..:..|:|  ..|..|.||            |.|.|.....:......:...||.|. 
  Fly   562 GVPGMACEDSQAKIDEEYMSLMAELG------------EGPPPPSASAKTDPPASNGPQLHRASY 614

  Fly   272 --AHGNQQQQQQVQHHHSHQAHFHQLLQQAHGGASAAAAACG---EHLSGQTTPATAAALHTTAM 331
              ......|.|.:|...|..:..|   |:..||..|||...|   ||..|........|.....|
  Fly   615 SIFDKKPSQMQAIQSPPSSSSRDH---QRDLGGWGAAAHEHGMGMEHGMGLDQHGHGLAAMDHGM 676

  Fly   332 AVALQHQLTAAGIGGLLKPA-TGVGATMAGLPTTQAGAAALQLPGDGESSGSTLTLLEPPGTALL 395
            ::.::|.:.|      ..|| .|..|.....|......:|.|.|              ||.|..|
  Fly   677 SLGMEHAMAA------YVPAPPGTQAPPPMPPPLMPWMSAPQPP--------------PPATEPL 721

  Fly   396 HPAL 399
            :|.:
  Fly   722 NPPI 725

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10384NP_001163254.2 SF1_like-KH 44..155 CDD:239088 38/116 (33%)
SF1NP_524654.2 MSL5 253..512 CDD:227503 46/138 (33%)
SF1-HH 274..385 CDD:292892 102/394 (26%)
SF1_like-KH 392..510 CDD:239088 42/129 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460735
Domainoid 1 1.000 45 1.000 Domainoid score I3083
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.