DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10384 and B0280.17

DIOPT Version :9

Sequence 1:NP_001163254.2 Gene:CG10384 / 37567 FlyBaseID:FBgn0034731 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001040836.2 Gene:B0280.17 / 4363051 WormBaseID:WBGene00044674 Length:260 Species:Caenorhabditis elegans


Alignment Length:154 Identity:41/154 - (26%)
Similarity:74/154 - (48%) Gaps:20/154 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KAGLSALEERSLKGSEKLKMLDITRDKPVKVAVKVAVPVRDHPKFNFVGKLLGPKGNSMKRLQED 68
            |.|.|   |...|...|.:.:|           ||..|.......|.||:|:||:|.::::|::|
 Worm   123 KNGCS---ENENKEEGKFEKID-----------KVFFPPETANNTNPVGRLIGPRGMTIRQLEKD 173

  Fly    69 TMCKMAVLGRGSMRDRRKEEELRGSGDSR--YAHLFEDLHVEISTFAAPAEAHARIAYALAEVRR 131
            ..||:.:.|:|..:|..|||.||    .|  :.||.|.:||.||..:...||.:....::.::.:
 Worm   174 LGCKLFIRGKGCTKDDAKEERLR----ERVGWEHLKEPIHVMISVRSDSEEAASEKLSSIKKMLQ 234

  Fly   132 FLVPDYHDDIRQEQMWEMQALTST 155
            ..:.....::::.|:.::..:..|
 Worm   235 EFLEHTDSELKRSQLMQLAVIEGT 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10384NP_001163254.2 SF1_like-KH 44..155 CDD:239088 30/112 (27%)
B0280.17NP_001040836.2 KH-I 141..260 CDD:381803 35/133 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.