DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10384 and how

DIOPT Version :9

Sequence 1:NP_001163254.2 Gene:CG10384 / 37567 FlyBaseID:FBgn0034731 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001262822.1 Gene:how / 42596 FlyBaseID:FBgn0264491 Length:418 Species:Drosophila melanogaster


Alignment Length:352 Identity:95/352 - (26%)
Similarity:157/352 - (44%) Gaps:80/352 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LKMLDITRDKP----VKVAVKVAVPVRDHPKFNFVGKLLGPKGNSMKRLQEDTMCKMAVLGRGSM 81
            :|...:|..:|    |.:..||.||||:||.|||||::|||:|.:.|:|:::|.||:.|.|:|||
  Fly   120 VKKEPLTLPEPEGSVVTMNEKVYVPVREHPDFNFVGRILGPRGMTAKQLEQETGCKIMVRGKGSM 184

  Fly    82 RDRRKEEELRGSGDSRYAHLFEDLHVEISTFAAPAEAHARIAYALAEVRRFLVP--DYHDDIRQE 144
            ||::||:..||.  ..:.||.:||||.|:.......|..::|.|:|||::.|||  :..|::::.
  Fly   185 RDKKKEDANRGK--PNWEHLSDDLHVLITVEDTENRATVKLAQAVAEVQKLLVPQAEGEDELKKR 247

  Fly   145 QMWEMQALTSTPALGAHSLEDSHSPTINSSSQVGGTTNSSSNGASGRGLGGGLADMD-----TSN 204
            |:.|:..:..|       ..|:.:.::.:.|.||          |...|...:.|.:     .::
  Fly   248 QLMELAIINGT-------YRDTTAKSVAAFSCVG----------SASYLYPAVCDEEWRRLVAAS 295

  Fly   205 DDKSDDASGMECLSAVDKLDCSSSCASLG----ISGITTISTTSPEHPHPHQHHQQHQQHQQHHA 265
            |.:...::|:..|:|..:   :.:.|.||    ::...|:.||:                    |
  Fly   296 DSRLLTSTGLPGLAAQIR---APAAAPLGAPLILNPRMTVPTTA--------------------A 337

  Fly   266 HLHPAHAHGNQQQQQQVQHHHSHQAHFHQLLQQAHGGASAA------AAACGEHLSGQTTPATAA 324
            .:..|.|              :..|.|.   |..||...|.      ||..|..|..:....:.|
  Fly   338 SILSAQA--------------APTAAFD---QTGHGMIFAPYDYANYAALAGNPLLTEYADHSGA 385

  Fly   325 ALHTTAMAVALQHQLTAAGIGGLLKPA 351
            ......:|...:|....|.:|...|||
  Fly   386 IKQQRRLATNREHPYQRATVGVPAKPA 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10384NP_001163254.2 SF1_like-KH 44..155 CDD:239088 46/112 (41%)
howNP_001262822.1 STAR_dimer 75..123 CDD:293152 1/2 (50%)
SF1_like-KH 139..260 CDD:239088 53/129 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460727
Domainoid 1 1.000 45 1.000 Domainoid score I3083
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D66954at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.