DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10384 and qkr58E-2

DIOPT Version :9

Sequence 1:NP_001163254.2 Gene:CG10384 / 37567 FlyBaseID:FBgn0034731 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001286724.1 Gene:qkr58E-2 / 37562 FlyBaseID:FBgn0022985 Length:416 Species:Drosophila melanogaster


Alignment Length:423 Identity:132/423 - (31%)
Similarity:184/423 - (43%) Gaps:131/423 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ALEERSLKG--SEKLKMLDITRDKPVKVAVKVAVPVRDHPKFNFVGKLLGPKGNSMKRLQEDTMC 71
            |||...|.|  ..:.:..|:.:.:.:|::.||.||::| .|||:|||||||||||::||||:|.|
  Fly   101 ALERVQLNGRIPTRDQYADVYQQRTIKLSQKVHVPIKD-KKFNYVGKLLGPKGNSLRRLQEETQC 164

  Fly    72 KMAVLGRGSMRDRRKEEELRGSGDSRYAHLFEDLHVEISTFAAPAEAHARIAYALAEVRRFLVPD 136
            |:.:|||.||:||.:|||||.|.|::||||...||||:||.|.||||:||:||||||:||:|.||
  Fly   165 KIVILGRFSMKDRAREEELRNSADAKYAHLNLPLHVEVSTIAPPAEAYARVAYALAEIRRYLTPD 229

  Fly   137 YHDDIRQEQMWEMQALTSTPALGAHSLEDSHSPTINSSSQVGGTTNSSSNGASGRGLGG-----G 196
            .||||||||..|:             :||..:....:..|:...:|::::||.|.|.||     |
  Fly   230 KHDDIRQEQYREL-------------MEDPEAAKKLTLRQLQQQSNAAASGAGGGGGGGGGNGNG 281

  Fly   197 LADMDTSNDDKSDDASGMECLSAVDKLDCSSSCASLGISGITTISTTSPEHPHPHQHHQQHQQHQ 261
            .|....||:...:..||                                      .:::|..|.|
  Fly   282 GAAGSGSNNGNGNQRSG--------------------------------------GNYRQKFQQQ 308

  Fly   262 QHHAHLHPAHAHGNQQQQQQVQHHHSHQAHFHQLLQQAHGGASAAAAACGEHLSGQTTPATAAAL 326
            .|:.|            .::..:..||...:|                       |..|...||.
  Fly   309 SHYRH------------NEETVYFRSHNNAYH-----------------------QPKPYVPAAQ 338

  Fly   327 HTTAMAVALQHQ-LTAAGIGGLLKPATGVGATMAGLPTTQAGAAALQLPGDGESSGSTLTLLEPP 390
            ...||...|..| :..|...|::..|.......|||               |.:.|..:      
  Fly   339 RGNAMHTTLPPQAIVRASPPGMVVSAASFNGRNAGL---------------GNAGGGGI------ 382

  Fly   391 GTALLHPALRNVKTINIGGGLG-------RKRP 416
                    :.|......|||:|       |.||
  Fly   383 --------MANSIVATTGGGIGGAVPPNMRYRP 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10384NP_001163254.2 SF1_like-KH 44..155 CDD:239088 73/110 (66%)
qkr58E-2NP_001286724.1 SF1_like-KH 129..244 CDD:239088 77/128 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468751
Domainoid 1 1.000 45 1.000 Domainoid score I3083
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26159
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.