DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10384 and qkia

DIOPT Version :9

Sequence 1:NP_001163254.2 Gene:CG10384 / 37567 FlyBaseID:FBgn0034731 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_571299.1 Gene:qkia / 30471 ZFINID:ZDB-GENE-990415-230 Length:383 Species:Danio rerio


Alignment Length:126 Identity:51/126 - (40%)
Similarity:82/126 - (65%) Gaps:4/126 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VKVAVKVAVPVRDHPKFNFVGKLLGPKGNSMKRLQEDTMCKMAVLGRGSMRDRRKEEELRGSGDS 96
            |.:..|:.|||:::|.:||||::|||:|.:.|:|:.:|.||:.|.||.||||::|||:.||.  .
Zfish    81 VHLQEKLFVPVKEYPDYNFVGRILGPRGLTAKQLEAETGCKIMVRGRSSMRDKKKEEQNRGK--P 143

  Fly    97 RYAHLFEDLHVEISTFAAPAEAHARIAYALAEVRRFLVP--DYHDDIRQEQMWEMQALTST 155
            .:.||.|||||.|:.......|..::..|:.||::.|||  :..|::::.|:.|:..|..|
Zfish   144 NWEHLNEDLHVLITVEDTQTRAEIKMRRAVEEVKKLLVPAAEGEDNLKKMQLMELAILNGT 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10384NP_001163254.2 SF1_like-KH 44..155 CDD:239088 45/112 (40%)
qkiaNP_571299.1 STAR_dimer 11..69 CDD:293152
SF1_like-KH 84..206 CDD:239088 50/123 (41%)
Quaking_NLS 356..383 CDD:293159
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590112
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.