DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10384 and KHDRBS2

DIOPT Version :9

Sequence 1:NP_001163254.2 Gene:CG10384 / 37567 FlyBaseID:FBgn0034731 Length:492 Species:Drosophila melanogaster
Sequence 2:XP_016865823.1 Gene:KHDRBS2 / 202559 HGNCID:18114 Length:413 Species:Homo sapiens


Alignment Length:195 Identity:89/195 - (45%)
Similarity:126/195 - (64%) Gaps:35/195 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSALEERSLKGS------EKLKMLDITRDKPVKVAVKVAVPVRDHPKFNFVGKLLGPKGNSMKRL 65
            |.|.|....:||      |:.|.||:..:|.:|::.:|.:||:.:||||||||||||:|||:|||
Human    27 LLAEEIEKFQGSDGKKEDEEKKYLDVISNKNIKLSERVLIPVKQYPKFNFVGKLLGPRGNSLKRL 91

  Fly    66 QEDTMCKMAVLGRGSMRDRRKEEELRGSGDSRYAHLFEDLHVEISTFAAPAEAHARIAYALAEVR 130
            ||:|..||::||:|||||:.||||||.||:::||||.::|||.|..||.|.||::|:::||.|::
Human    92 QEETGAKMSILGKGSMRDKAKEEELRKSGEAKYAHLSDELHVLIEVFAPPGEAYSRMSHALEEIK 156

  Fly   131 RFLVPDYHDDIRQEQMWEMQALTSTPALGAHSLEDSHSPTINSSSQVGGTTNSSSNGASGRGLGG 195
            :||||||:|:|||||:.|:..|                             |.|.:...|||:.|
Human   157 KFLVPDYNDEIRQEQLRELSYL-----------------------------NGSEDSGRGRGIRG 192

  Fly   196  195
            Human   193  192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10384NP_001163254.2 SF1_like-KH 44..155 CDD:239088 69/110 (63%)
KHDRBS2XP_016865823.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155060
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2939
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.