DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10384 and Khdrbs1

DIOPT Version :9

Sequence 1:NP_001163254.2 Gene:CG10384 / 37567 FlyBaseID:FBgn0034731 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_035447.3 Gene:Khdrbs1 / 20218 MGIID:893579 Length:443 Species:Mus musculus


Alignment Length:200 Identity:90/200 - (45%)
Similarity:118/200 - (59%) Gaps:29/200 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSALEERSLKGSEKL----KMLDITRDKPVKVAVKVAVPVRDHPKFNFVGKLLGPKGNSMKRLQE 67
            ||...|:..||..|.    ..||:...|.:|:..:|.:||:.:||||||||:|||:||::|||||
Mouse   125 LSVEIEKIQKGESKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQGNTIKRLQE 189

  Fly    68 DTMCKMAVLGRGSMRDRRKEEELRGSGDSRYAHLFEDLHVEISTFAAPAEAHARIAYALAEVRRF 132
            :|..|::|||:|||||:.||||||..||.:||||..||||.|..|..|.||:|.:|:|:.||::|
Mouse   190 ETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKF 254

  Fly   133 LVPDYHDDIRQEQMWEMQALTSTPALGAHSLEDSHSPTINSSSQVGGTTNSSSNGAS-------- 189
            ||||..|||.|||..|:..|...|           .|:......|.|      .||:        
Mouse   255 LVPDMMDDICQEQFLELSYLNGVP-----------EPSRGRGVSVRG------RGAAPPPPPVPR 302

  Fly   190 GRGLG 194
            |||:|
Mouse   303 GRGVG 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10384NP_001163254.2 SF1_like-KH 44..155 CDD:239088 67/110 (61%)
Khdrbs1NP_035447.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..94
Involved in homodimerization. /evidence=ECO:0000250|UniProtKB:Q07666 100..260 72/134 (54%)
Qua1 103..153 CDD:318503 8/27 (30%)
SF1_like-KH 157..276 CDD:239088 70/118 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..317 8/33 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 326..345
Interaction with HNRNPA1. /evidence=ECO:0000250|UniProtKB:Q07666 351..443
Sam68-YY 366..415 CDD:318716
Interaction with ZBTB7A. /evidence=ECO:0000250|UniProtKB:Q07666 400..420
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 411..443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845531
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.