DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10384 and Qki

DIOPT Version :10

Sequence 1:NP_611673.3 Gene:CG10384 / 37567 FlyBaseID:FBgn0034731 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001152989.1 Gene:Qki / 19317 MGIID:97837 Length:341 Species:Mus musculus


Alignment Length:142 Identity:59/142 - (41%)
Similarity:90/142 - (63%) Gaps:13/142 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VKVAVKVAVPVRDHPKFNFVGKLLGPKGNSMKRLQEDTMCKMAVLGRGSMRDRRKEEELRGSGDS 96
            |::..|:.|||:::|.|||||::|||:|.:.|:|:.:|.||:.|.|:|||||::|||:.||.  .
Mouse    80 VQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGK--P 142

  Fly    97 RYAHLFEDLHVEISTFAAPAEAHARIAYALAEVRRFLVP--DYHDDIRQEQMWEMQALTST---- 155
            .:.||.|||||.|:...|...|..::..|:.||::.|||  :..|.:::.|:.|:..|..|    
Mouse   143 NWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDA 207

  Fly   156 ----PALGAHSL 163
                ||| |.||
Mouse   208 NIKSPAL-AFSL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10384NP_611673.3 KH-I_KHDRBS 43..131 CDD:411812 40/87 (46%)
QkiNP_001152989.1 STAR_dimer 10..64 CDD:435414
Qua1 domain, involved in homodimerization. /evidence=ECO:0000250|UniProtKB:Q17339 11..82 1/1 (100%)
KH-I_Hqk 81..183 CDD:411893 47/103 (46%)
Qua2 domain, involved in RNA binding. /evidence=ECO:0000250|UniProtKB:Q96PU8 182..213 5/30 (17%)
PHA03247 <211..314 CDD:223021 6/9 (67%)
SH3-binding 276..279
Quaking_NLS 312..341 CDD:435421
Nuclear localization signal. /evidence=ECO:0000269|PubMed:10506177, ECO:0000269|PubMed:29021242 324..330
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.