DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10384 and Khdrbs2

DIOPT Version :9

Sequence 1:NP_001163254.2 Gene:CG10384 / 37567 FlyBaseID:FBgn0034731 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_579852.1 Gene:Khdrbs2 / 170843 RGDID:621738 Length:349 Species:Rattus norvegicus


Alignment Length:195 Identity:89/195 - (45%)
Similarity:125/195 - (64%) Gaps:35/195 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSALEERSLKGS------EKLKMLDITRDKPVKVAVKVAVPVRDHPKFNFVGKLLGPKGNSMKRL 65
            |.|.|....:||      |:.|.||:..:|.:|::.:|.:||:.:||||||||||||:|||:|||
  Rat    27 LLAEEIEKFQGSDGRKEDEEKKYLDVISNKNIKLSERVLIPVKQYPKFNFVGKLLGPRGNSLKRL 91

  Fly    66 QEDTMCKMAVLGRGSMRDRRKEEELRGSGDSRYAHLFEDLHVEISTFAAPAEAHARIAYALAEVR 130
            ||:|..||::||:|||||:.||||||.||:::||||.::|||.|..||.|.||::|:::||.|::
  Rat    92 QEETGAKMSILGKGSMRDKAKEEELRKSGEAKYAHLSDELHVLIEVFAPPGEAYSRMSHALEEIK 156

  Fly   131 RFLVPDYHDDIRQEQMWEMQALTSTPALGAHSLEDSHSPTINSSSQVGGTTNSSSNGASGRGLGG 195
            :||||||:|:|||||:.|:..|                             |.|.....|||:.|
  Rat   157 KFLVPDYNDEIRQEQLRELSYL-----------------------------NGSEESGRGRGIRG 192

  Fly   196  195
              Rat   193  192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10384NP_001163254.2 SF1_like-KH 44..155 CDD:239088 69/110 (63%)
Khdrbs2NP_579852.1 Qua1 6..57 CDD:292891 9/29 (31%)
SF1_like-KH 61..180 CDD:239088 72/147 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 181..263 5/12 (42%)
Sam68-YY 271..321 CDD:293176
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 320..349
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348934
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.