DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10384 and Khdrbs2

DIOPT Version :9

Sequence 1:NP_001163254.2 Gene:CG10384 / 37567 FlyBaseID:FBgn0034731 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_573498.1 Gene:Khdrbs2 / 170771 MGIID:2159649 Length:349 Species:Mus musculus


Alignment Length:195 Identity:89/195 - (45%)
Similarity:125/195 - (64%) Gaps:35/195 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSALEERSLKGS------EKLKMLDITRDKPVKVAVKVAVPVRDHPKFNFVGKLLGPKGNSMKRL 65
            |.|.|....:||      |:.|.||:..:|.:|::.:|.:||:.:||||||||||||:|||:|||
Mouse    27 LLAEEIEKFQGSDGKKEDEEKKYLDVISNKNIKLSERVLIPVKQYPKFNFVGKLLGPRGNSLKRL 91

  Fly    66 QEDTMCKMAVLGRGSMRDRRKEEELRGSGDSRYAHLFEDLHVEISTFAAPAEAHARIAYALAEVR 130
            ||:|..||::||:|||||:.||||||.||:::||||.::|||.|..||.|.||::|:::||.|::
Mouse    92 QEETGAKMSILGKGSMRDKTKEEELRKSGEAKYAHLSDELHVLIEVFAPPGEAYSRMSHALEEIK 156

  Fly   131 RFLVPDYHDDIRQEQMWEMQALTSTPALGAHSLEDSHSPTINSSSQVGGTTNSSSNGASGRGLGG 195
            :||||||:|:|||||:.|:..|                             |.|.....|||:.|
Mouse   157 KFLVPDYNDEIRQEQLRELSYL-----------------------------NGSEESGRGRGIRG 192

  Fly   196  195
            Mouse   193  192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10384NP_001163254.2 SF1_like-KH 44..155 CDD:239088 69/110 (63%)
Khdrbs2NP_573498.1 Qua1 6..57 CDD:292891 9/29 (31%)
SF1_like-KH 61..180 CDD:239088 72/147 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 181..263 5/12 (42%)
Sam68-YY 267..321 CDD:293176
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 321..349
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845523
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2939
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.