Sequence 1: | NP_001163254.2 | Gene: | CG10384 / 37567 | FlyBaseID: | FBgn0034731 | Length: | 492 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_573498.1 | Gene: | Khdrbs2 / 170771 | MGIID: | 2159649 | Length: | 349 | Species: | Mus musculus |
Alignment Length: | 195 | Identity: | 89/195 - (45%) |
---|---|---|---|
Similarity: | 125/195 - (64%) | Gaps: | 35/195 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 LSALEERSLKGS------EKLKMLDITRDKPVKVAVKVAVPVRDHPKFNFVGKLLGPKGNSMKRL 65
Fly 66 QEDTMCKMAVLGRGSMRDRRKEEELRGSGDSRYAHLFEDLHVEISTFAAPAEAHARIAYALAEVR 130
Fly 131 RFLVPDYHDDIRQEQMWEMQALTSTPALGAHSLEDSHSPTINSSSQVGGTTNSSSNGASGRGLGG 195
Fly 196 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10384 | NP_001163254.2 | SF1_like-KH | 44..155 | CDD:239088 | 69/110 (63%) |
Khdrbs2 | NP_573498.1 | Qua1 | 6..57 | CDD:292891 | 9/29 (31%) |
SF1_like-KH | 61..180 | CDD:239088 | 72/147 (49%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 181..263 | 5/12 (42%) | |||
Sam68-YY | 267..321 | CDD:293176 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 321..349 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167845523 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S2939 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR11208 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.890 |