Sequence 1: | NP_001163254.2 | Gene: | CG10384 / 37567 | FlyBaseID: | FBgn0034731 | Length: | 492 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_569089.1 | Gene: | Khdrbs1 / 117268 | RGDID: | 621459 | Length: | 443 | Species: | Rattus norvegicus |
Alignment Length: | 200 | Identity: | 90/200 - (45%) |
---|---|---|---|
Similarity: | 118/200 - (59%) | Gaps: | 29/200 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 LSALEERSLKGSEKL----KMLDITRDKPVKVAVKVAVPVRDHPKFNFVGKLLGPKGNSMKRLQE 67
Fly 68 DTMCKMAVLGRGSMRDRRKEEELRGSGDSRYAHLFEDLHVEISTFAAPAEAHARIAYALAEVRRF 132
Fly 133 LVPDYHDDIRQEQMWEMQALTSTPALGAHSLEDSHSPTINSSSQVGGTTNSSSNGAS-------- 189
Fly 190 GRGLG 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10384 | NP_001163254.2 | SF1_like-KH | 44..155 | CDD:239088 | 67/110 (61%) |
Khdrbs1 | NP_569089.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..95 | ||
Involved in homodimerization. /evidence=ECO:0000250|UniProtKB:Q07666 | 100..260 | 72/134 (54%) | |||
Qua1 | 102..153 | CDD:406639 | 8/27 (30%) | ||
KH-I | 152..257 | CDD:412160 | 61/104 (59%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 280..317 | 8/33 (24%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 326..345 | ||||
Interaction with HNRNPA1. /evidence=ECO:0000250|UniProtKB:Q07666 | 351..443 | ||||
Sam68-YY | 366..415 | CDD:406871 | |||
Interaction with ZBTB7A. /evidence=ECO:0000250|UniProtKB:Q07666 | 400..420 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 411..443 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166348942 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1012406at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR11208 |
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.950 |