DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10384 and Khdrbs1

DIOPT Version :9

Sequence 1:NP_001163254.2 Gene:CG10384 / 37567 FlyBaseID:FBgn0034731 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_569089.1 Gene:Khdrbs1 / 117268 RGDID:621459 Length:443 Species:Rattus norvegicus


Alignment Length:200 Identity:90/200 - (45%)
Similarity:118/200 - (59%) Gaps:29/200 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSALEERSLKGSEKL----KMLDITRDKPVKVAVKVAVPVRDHPKFNFVGKLLGPKGNSMKRLQE 67
            ||...|:..||..|.    ..||:...|.:|:..:|.:||:.:||||||||:|||:||::|||||
  Rat   125 LSVEIEKIQKGESKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQGNTIKRLQE 189

  Fly    68 DTMCKMAVLGRGSMRDRRKEEELRGSGDSRYAHLFEDLHVEISTFAAPAEAHARIAYALAEVRRF 132
            :|..|::|||:|||||:.||||||..||.:||||..||||.|..|..|.||:|.:|:|:.||::|
  Rat   190 ETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKF 254

  Fly   133 LVPDYHDDIRQEQMWEMQALTSTPALGAHSLEDSHSPTINSSSQVGGTTNSSSNGAS-------- 189
            ||||..|||.|||..|:..|...|           .|:......|.|      .||:        
  Rat   255 LVPDMMDDICQEQFLELSYLNGVP-----------EPSRGRGVSVRG------RGAAPPPPPVPR 302

  Fly   190 GRGLG 194
            |||:|
  Rat   303 GRGVG 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10384NP_001163254.2 SF1_like-KH 44..155 CDD:239088 67/110 (61%)
Khdrbs1NP_569089.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..95
Involved in homodimerization. /evidence=ECO:0000250|UniProtKB:Q07666 100..260 72/134 (54%)
Qua1 102..153 CDD:406639 8/27 (30%)
KH-I 152..257 CDD:412160 61/104 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..317 8/33 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 326..345
Interaction with HNRNPA1. /evidence=ECO:0000250|UniProtKB:Q07666 351..443
Sam68-YY 366..415 CDD:406871
Interaction with ZBTB7A. /evidence=ECO:0000250|UniProtKB:Q07666 400..420
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 411..443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348942
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.